BLASTX nr result
ID: Angelica27_contig00040123
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00040123 (367 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017216141.1 PREDICTED: protein ODORANT1-like [Daucus carota s... 87 1e-17 >XP_017216141.1 PREDICTED: protein ODORANT1-like [Daucus carota subsp. sativus] XP_017216142.1 PREDICTED: protein ODORANT1-like [Daucus carota subsp. sativus] KZM88308.1 hypothetical protein DCAR_025383 [Daucus carota subsp. sativus] Length = 369 Score = 86.7 bits (213), Expect = 1e-17 Identities = 40/51 (78%), Positives = 44/51 (86%) Frame = +3 Query: 3 SGDWSFSEGNGESDNVGAETNKNYWNSVLDLVDTSPSHNVVNSSASDSALL 155 SGDWS+ EGNGESDN G ETNKNYW SVLD+V TSPSHN+VNS ASDS +L Sbjct: 319 SGDWSYFEGNGESDNGGDETNKNYWTSVLDMVVTSPSHNMVNSCASDSPVL 369