BLASTX nr result
ID: Angelica27_contig00040098
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00040098 (406 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017230207.1 PREDICTED: filament-like plant protein 3 [Daucus ... 54 9e-06 KHN16929.1 Filament-like plant protein 3 [Glycine soja] 54 9e-06 XP_006584664.1 PREDICTED: filament-like plant protein 3 [Glycine... 54 9e-06 >XP_017230207.1 PREDICTED: filament-like plant protein 3 [Daucus carota subsp. sativus] XP_017230208.1 PREDICTED: filament-like plant protein 3 [Daucus carota subsp. sativus] Length = 662 Score = 53.9 bits (128), Expect = 9e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -2 Query: 405 KTIASLGRQLKSLATLEDFIMDSDEPSTITEG 310 KTIASLGRQLKSLATLEDF+ DSD P TI+ G Sbjct: 625 KTIASLGRQLKSLATLEDFLSDSDNPCTISRG 656 >KHN16929.1 Filament-like plant protein 3 [Glycine soja] Length = 682 Score = 53.9 bits (128), Expect = 9e-06 Identities = 36/84 (42%), Positives = 47/84 (55%), Gaps = 4/84 (4%) Frame = -2 Query: 405 KTIASLGRQLKSLATLEDFIMDSDEP----STITEGYDY*RDHSHP*IMSH*FHWSDLIF 238 KTIASLG+QLKSLATLEDF++DSD P +T+G+ +H P H SDL Sbjct: 594 KTIASLGQQLKSLATLEDFLLDSDNPMESTCEVTKGHQNGGEHLKP-------HHSDLSL 646 Query: 237 AEKNLSSKLFGVKYLNVQVLRRKS 166 +K+ S + LN + KS Sbjct: 647 PKKDSESPV----SLNSSITNEKS 666 >XP_006584664.1 PREDICTED: filament-like plant protein 3 [Glycine max] XP_006584665.1 PREDICTED: filament-like plant protein 3 [Glycine max] XP_006584666.1 PREDICTED: filament-like plant protein 3 [Glycine max] XP_014634091.1 PREDICTED: filament-like plant protein 3 [Glycine max] XP_014634092.1 PREDICTED: filament-like plant protein 3 [Glycine max] XP_014634093.1 PREDICTED: filament-like plant protein 3 [Glycine max] XP_014634094.1 PREDICTED: filament-like plant protein 3 [Glycine max] KRH40980.1 hypothetical protein GLYMA_08G003200 [Glycine max] KRH40981.1 hypothetical protein GLYMA_08G003200 [Glycine max] KRH40982.1 hypothetical protein GLYMA_08G003200 [Glycine max] KRH40983.1 hypothetical protein GLYMA_08G003200 [Glycine max] KRH40984.1 hypothetical protein GLYMA_08G003200 [Glycine max] KRH40985.1 hypothetical protein GLYMA_08G003200 [Glycine max] Length = 682 Score = 53.9 bits (128), Expect = 9e-06 Identities = 36/84 (42%), Positives = 47/84 (55%), Gaps = 4/84 (4%) Frame = -2 Query: 405 KTIASLGRQLKSLATLEDFIMDSDEP----STITEGYDY*RDHSHP*IMSH*FHWSDLIF 238 KTIASLG+QLKSLATLEDF++DSD P +T+G+ +H P H SDL Sbjct: 594 KTIASLGQQLKSLATLEDFLLDSDNPMESTCEVTKGHQNGGEHLKP-------HHSDLSL 646 Query: 237 AEKNLSSKLFGVKYLNVQVLRRKS 166 +K+ S + LN + KS Sbjct: 647 PKKDSESPV----SLNSSITNEKS 666