BLASTX nr result
ID: Angelica27_contig00038442
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00038442 (316 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABK23395.1 unknown [Picea sitchensis] ABK25747.1 unknown [Picea ... 68 9e-13 ERN19999.1 hypothetical protein AMTR_s00071p00157560 [Amborella ... 55 1e-07 ERN19997.1 hypothetical protein AMTR_s00071p00156280 [Amborella ... 55 2e-07 XP_006858531.2 PREDICTED: uncharacterized protein LOC18448408 [A... 53 5e-07 ERN19998.1 hypothetical protein AMTR_s00071p00157070 [Amborella ... 53 8e-07 OMO52260.1 hypothetical protein COLO4_37302 [Corchorus olitorius] 53 1e-06 OMO94787.1 hypothetical protein CCACVL1_05815 [Corchorus capsula... 52 4e-06 >ABK23395.1 unknown [Picea sitchensis] ABK25747.1 unknown [Picea sitchensis] Length = 103 Score = 68.2 bits (165), Expect = 9e-13 Identities = 30/50 (60%), Positives = 36/50 (72%) Frame = +2 Query: 167 EDDKCSSEVNQLINSCSNIVQGGTPSRECCGLIRSADFKCVCSKVTPPIA 316 E DKC +++ L+N CS I+ G +PS CCGLIRSAD CVC KVTP IA Sbjct: 23 EADKCGNQIQGLLNKCSPILLGKSPSAACCGLIRSADMGCVCPKVTPQIA 72 >ERN19999.1 hypothetical protein AMTR_s00071p00157560 [Amborella trichopoda] Length = 107 Score = 55.1 bits (131), Expect = 1e-07 Identities = 20/46 (43%), Positives = 30/46 (65%) Frame = +2 Query: 179 CSSEVNQLINSCSNIVQGGTPSRECCGLIRSADFKCVCSKVTPPIA 316 C SEV +N+C +V G P++ECC IR+ +C+C K+TP +A Sbjct: 30 CKSEVRTFVNACKALVYGNPPTQECCAAIRTVHTECICPKITPRLA 75 >ERN19997.1 hypothetical protein AMTR_s00071p00156280 [Amborella trichopoda] Length = 134 Score = 55.1 bits (131), Expect = 2e-07 Identities = 22/46 (47%), Positives = 29/46 (63%) Frame = +2 Query: 179 CSSEVNQLINSCSNIVQGGTPSRECCGLIRSADFKCVCSKVTPPIA 316 C +EV L+NSC ++ G PS CC IR+A CVC K+TP +A Sbjct: 30 CKAEVRSLVNSCKPVLYGKVPSSACCAAIRAAHVGCVCPKITPRLA 75 >XP_006858531.2 PREDICTED: uncharacterized protein LOC18448408 [Amborella trichopoda] Length = 95 Score = 53.1 bits (126), Expect = 5e-07 Identities = 20/47 (42%), Positives = 32/47 (68%) Frame = +2 Query: 176 KCSSEVNQLINSCSNIVQGGTPSRECCGLIRSADFKCVCSKVTPPIA 316 +C EV+ +++C ++V G PS ECC + R+A +C+C KVTP +A Sbjct: 18 QCKGEVSTAVHACISVVYRGFPSPECCAIARTAHTECICPKVTPKLA 64 >ERN19998.1 hypothetical protein AMTR_s00071p00157070 [Amborella trichopoda] Length = 111 Score = 53.1 bits (126), Expect = 8e-07 Identities = 20/47 (42%), Positives = 32/47 (68%) Frame = +2 Query: 176 KCSSEVNQLINSCSNIVQGGTPSRECCGLIRSADFKCVCSKVTPPIA 316 +C EV+ +++C ++V G PS ECC + R+A +C+C KVTP +A Sbjct: 34 QCKGEVSTAVHACISVVYRGFPSPECCAIARTAHTECICPKVTPKLA 80 >OMO52260.1 hypothetical protein COLO4_37302 [Corchorus olitorius] Length = 113 Score = 52.8 bits (125), Expect = 1e-06 Identities = 21/47 (44%), Positives = 30/47 (63%) Frame = +2 Query: 176 KCSSEVNQLINSCSNIVQGGTPSRECCGLIRSADFKCVCSKVTPPIA 316 +C E N L+N+C I+ G +PS ECC +R + +CVC VTP +A Sbjct: 39 QCKEEKNLLVNACKAIILGSSPSPECCERVRVSHVECVCPLVTPQVA 85 >OMO94787.1 hypothetical protein CCACVL1_05815 [Corchorus capsularis] Length = 118 Score = 51.6 bits (122), Expect = 4e-06 Identities = 20/47 (42%), Positives = 29/47 (61%) Frame = +2 Query: 176 KCSSEVNQLINSCSNIVQGGTPSRECCGLIRSADFKCVCSKVTPPIA 316 +C E N L+N+C ++ G +PS ECC +R + CVC VTP +A Sbjct: 41 QCKEEKNLLVNACKAVILGSSPSPECCQRVRLSHVDCVCPLVTPQVA 87