BLASTX nr result
ID: Angelica27_contig00038407
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00038407 (309 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006442007.1 hypothetical protein CICLE_v10024286mg [Citrus cl... 67 9e-12 XP_017217150.1 PREDICTED: uncharacterized protein LOC108194712 [... 63 5e-10 XP_019427131.1 PREDICTED: uncharacterized protein LOC109335454 [... 64 7e-10 GAV59185.1 zf-BED domain-containing protein, partial [Cephalotus... 60 2e-09 XP_019454971.1 PREDICTED: zinc finger BED domain-containing prot... 60 6e-09 XP_017217151.1 PREDICTED: zinc finger BED domain-containing prot... 60 1e-08 GAU51856.1 hypothetical protein TSUD_416400 [Trifolium subterran... 60 2e-08 OIW02282.1 hypothetical protein TanjilG_11176 [Lupinus angustifo... 58 2e-08 XP_012575080.1 PREDICTED: zinc finger BED domain-containing prot... 60 3e-08 KZV58677.1 hypothetical protein F511_24318 [Dorcoceras hygrometr... 57 4e-08 GAU51574.1 hypothetical protein TSUD_85550 [Trifolium subterraneum] 59 4e-08 XP_017183350.1 PREDICTED: zinc finger BED domain-containing prot... 59 4e-08 KNA10033.1 hypothetical protein SOVF_148100 [Spinacia oleracea] 59 5e-08 KHN22193.1 Putative AC9 transposase, partial [Glycine soja] 58 8e-08 XP_016185489.1 PREDICTED: zinc finger BED domain-containing prot... 57 9e-08 XP_017187384.1 PREDICTED: zinc finger BED domain-containing prot... 58 1e-07 XP_014634062.1 PREDICTED: zinc finger BED domain-containing prot... 57 2e-07 XP_014629697.1 PREDICTED: zinc finger BED domain-containing prot... 57 2e-07 XP_014617524.1 PREDICTED: zinc finger BED domain-containing prot... 56 2e-07 XP_014633991.1 PREDICTED: zinc finger BED domain-containing prot... 57 2e-07 >XP_006442007.1 hypothetical protein CICLE_v10024286mg [Citrus clementina] ESR55247.1 hypothetical protein CICLE_v10024286mg [Citrus clementina] Length = 181 Score = 67.4 bits (163), Expect = 9e-12 Identities = 35/84 (41%), Positives = 51/84 (60%) Frame = +3 Query: 51 VWNHFVRKKIDGVMKAVCKYCSKPLVGDLGSGTLHLRKHFQNKHHNKTAGGNIRQRLLLS 230 VWNHF R+KI+G +KA+C C+ LV +GSGT HL KH K I+ L + Sbjct: 54 VWNHFTRQKINGQLKAICNKCNGKLV--VGSGTNHLHKHLLRCPRCKQP--TIKNATLNA 109 Query: 231 NLNKNHPELASYSFNHDA*KKELA 302 +NK ++ ++SF+HD ++ELA Sbjct: 110 TINKGKVQVGAFSFDHDTSRRELA 133 >XP_017217150.1 PREDICTED: uncharacterized protein LOC108194712 [Daucus carota subsp. sativus] Length = 175 Score = 62.8 bits (151), Expect = 5e-10 Identities = 34/85 (40%), Positives = 43/85 (50%) Frame = +3 Query: 51 VWNHFVRKKIDGVMKAVCKYCSKPLVGDLGSGTLHLRKHFQNKHHNKTAGGNIRQRLLLS 230 VWNH+ +K +D V+KAVCKYCSK L GD GS Sbjct: 74 VWNHYTKKTLDDVLKAVCKYCSKQLKGDSGS----------------------------- 104 Query: 231 NLNKNHPELASYSFNHDA*KKELAK 305 +HP+LA+Y+FN +A K ELAK Sbjct: 105 ----DHPQLAAYNFNQEAAKTELAK 125 >XP_019427131.1 PREDICTED: uncharacterized protein LOC109335454 [Lupinus angustifolius] Length = 567 Score = 64.3 bits (155), Expect = 7e-10 Identities = 37/86 (43%), Positives = 47/86 (54%), Gaps = 1/86 (1%) Frame = +3 Query: 51 VWNHFVRKKIDGVMKAVCKYCSKPLVGDLGSGTLHLRKHFQNKHHNKTAGGNIRQRLLLS 230 VWNHF R + DG KA YC K L+GDL GT HL HF K + +I+Q LL + Sbjct: 448 VWNHFKRHREDGKWKAAYNYCGKRLLGDLSQGTKHLHNHF--KSCLRRTNSDIKQALLKT 505 Query: 231 NLNKNHPEL-ASYSFNHDA*KKELAK 305 L SY+FN +A ++ LAK Sbjct: 506 AKKGTESLLVGSYAFNQEAARRALAK 531 >GAV59185.1 zf-BED domain-containing protein, partial [Cephalotus follicularis] Length = 100 Score = 59.7 bits (143), Expect = 2e-09 Identities = 33/86 (38%), Positives = 50/86 (58%), Gaps = 2/86 (2%) Frame = +3 Query: 51 VWNHFVRKKIDGVMKAVCKYCSKPLVGDLGSGTLHLRKHFQNKHHNKTAGGNIRQRLLLS 230 VWNHF RK IDG K++ YC K L D + T HLR+H K K ++ Q +L + Sbjct: 7 VWNHFERKNIDGKRKSIFHYCKKELGADSRNVTSHLREHI--KRCPKRVTKDLHQMVLTT 64 Query: 231 NLNKNHPELA--SYSFNHDA*KKELA 302 N NK +++ +Y+++ D ++ELA Sbjct: 65 NKNKAEGKMSIGNYAYDPDVARRELA 90 >XP_019454971.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 3-like [Lupinus angustifolius] Length = 182 Score = 60.1 bits (144), Expect = 6e-09 Identities = 34/88 (38%), Positives = 48/88 (54%), Gaps = 2/88 (2%) Frame = +3 Query: 51 VWNHFVRKKIDGVMKAVCKYCSKPLVGDLGSGTLHLRKHFQNKHHNK--TAGGNIRQRLL 224 VW HF + K++GV KA CKYC K L G +GT HL H + K T G + Q L Sbjct: 53 VWEHFEKIKVNGVDKAECKYCEKKLGGGSKNGTKHLHNHIELCVQKKIMTRGNDKGQSFL 112 Query: 225 LSNLNKNHPELASYSFNHDA*KKELAKA 308 + +++ EL +++ + KKELA A Sbjct: 113 MLKASQDKQELGVGTYDAENTKKELASA 140 >XP_017217151.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Daucus carota subsp. sativus] Length = 378 Score = 60.5 bits (145), Expect = 1e-08 Identities = 32/85 (37%), Positives = 42/85 (49%) Frame = +3 Query: 51 VWNHFVRKKIDGVMKAVCKYCSKPLVGDLGSGTLHLRKHFQNKHHNKTAGGNIRQRLLLS 230 VWNH+ +K +D V+KAVCKYCSK L GD GS Sbjct: 55 VWNHYTKKTLDDVLKAVCKYCSKQLKGDSGS----------------------------- 85 Query: 231 NLNKNHPELASYSFNHDA*KKELAK 305 +HP+LA+Y+FN + K E+AK Sbjct: 86 ----DHPQLAAYNFNQEVAKTEIAK 106 >GAU51856.1 hypothetical protein TSUD_416400 [Trifolium subterraneum] Length = 246 Score = 59.7 bits (143), Expect = 2e-08 Identities = 33/86 (38%), Positives = 48/86 (55%), Gaps = 1/86 (1%) Frame = +3 Query: 51 VWNHFVRKKIDGVMKAVCKYCSKPLVGDLGSGTLHLRKHFQNKHHNKTAGGNIRQRLLLS 230 VW HF R+KID MKA+C YC LVG+ GT HL+ H+ K + +I+Q L+ + Sbjct: 65 VWLHFKRQKIDEKMKAICNYCGAKLVGNPKHGTSHLKAHY--KSCPRRTNRDIKQALIKT 122 Query: 231 NLNKNHPEL-ASYSFNHDA*KKELAK 305 + + SY+FN D + +AK Sbjct: 123 EQVEGQTVMVGSYAFNQDVARHAVAK 148 >OIW02282.1 hypothetical protein TanjilG_11176 [Lupinus angustifolius] Length = 139 Score = 57.8 bits (138), Expect = 2e-08 Identities = 27/58 (46%), Positives = 37/58 (63%) Frame = +3 Query: 51 VWNHFVRKKIDGVMKAVCKYCSKPLVGDLGSGTLHLRKHFQNKHHNKTAGGNIRQRLL 224 +WNHFVR+ +DG KA C YC K L+GD GT H+ HF++ H + +I+Q LL Sbjct: 57 IWNHFVRR-VDGKWKAACNYCGKRLLGDPSQGTNHVHNHFKSCIHR--SNSDIKQALL 111 >XP_012575080.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Cicer arietinum] Length = 349 Score = 59.7 bits (143), Expect = 3e-08 Identities = 34/87 (39%), Positives = 46/87 (52%), Gaps = 1/87 (1%) Frame = +3 Query: 51 VWNHFVRKKIDGVMKAVCKYCSKPLVGDLGSGTLHLRKHFQ-NKHHNKTAGGNIRQRLLL 227 VW+HF + K+DG KA C YC K L G GT HL H + H T G N RQ L Sbjct: 70 VWDHFTKVKVDGKEKAKCNYCKKLLGGRARDGTSHLCGHMKICTPHLSTIGHNNRQTFLT 129 Query: 228 SNLNKNHPELASYSFNHDA*KKELAKA 308 + + + EL + ++ + +KELA A Sbjct: 130 AKVLQGKKELGTVIYDAENARKELAHA 156 >KZV58677.1 hypothetical protein F511_24318 [Dorcoceras hygrometricum] Length = 137 Score = 57.0 bits (136), Expect = 4e-08 Identities = 34/84 (40%), Positives = 44/84 (52%), Gaps = 1/84 (1%) Frame = +3 Query: 54 WNHFVRKKIDGVMKAVCKYCSKPLVGDLGSGTLHLRKHFQNKHHNKTAGGNIRQRLLL-S 230 W HF RK I G KA+C C K L G+ +GT HL H + H K NI++ LL + Sbjct: 15 WAHFERKLIGGKWKAICNDCKKALGGETKNGTRHLLDHMKTCLHKKQK--NIKKSLLQPT 72 Query: 231 NLNKNHPELASYSFNHDA*KKELA 302 + L +Y FN D +KELA Sbjct: 73 KVTDEAMVLGTYHFNQDHARKELA 96 >GAU51574.1 hypothetical protein TSUD_85550 [Trifolium subterraneum] Length = 625 Score = 59.3 bits (142), Expect = 4e-08 Identities = 33/86 (38%), Positives = 48/86 (55%), Gaps = 1/86 (1%) Frame = +3 Query: 51 VWNHFVRKKIDGVMKAVCKYCSKPLVGDLGSGTLHLRKHFQNKHHNKTAGGNIRQRLLLS 230 VW HF R+KID MKA+C YC LVG+ GT HL+ H+ K + +I+Q L+ + Sbjct: 65 VWLHFKRQKIDEKMKAICNYCGAKLVGNPKHGTSHLKAHY--KSCPRRTNRDIKQALIKT 122 Query: 231 NLNKNHPEL-ASYSFNHDA*KKELAK 305 + + SY+FN D + +AK Sbjct: 123 EQVEGQTVMVGSYAFNQDVARHVVAK 148 >XP_017183350.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Malus domestica] Length = 894 Score = 59.3 bits (142), Expect = 4e-08 Identities = 32/87 (36%), Positives = 48/87 (55%), Gaps = 2/87 (2%) Frame = +3 Query: 51 VWNHFVRKKIDGVMKAVCKYCSKPLVGDLGSGTLHLRKHFQNKHHNKTAGGNIRQRLLLS 230 VW H+ R +DGVMKA+C YCSK L G+ +GT HLR H+ T RQ+ L Sbjct: 83 VWQHYTRTLVDGVMKAICNYCSKKLGGNTXNGTSHLR-------HHVTICPRXRQKXLKQ 135 Query: 231 NLNK--NHPELASYSFNHDA*KKELAK 305 L + ++ Y+F+ + ++ LA+ Sbjct: 136 TLTQKVGDGKVELYTFDQEXARRALAQ 162 >KNA10033.1 hypothetical protein SOVF_148100 [Spinacia oleracea] Length = 527 Score = 58.9 bits (141), Expect = 5e-08 Identities = 32/85 (37%), Positives = 49/85 (57%), Gaps = 1/85 (1%) Frame = +3 Query: 51 VWNHFVRKKIDGVMKAVCKYCSKPLVGDLGSGTLHLRKHFQNKHHNKTAGGNIRQRLLLS 230 VWNHF RK I+G KA C +C++ G+ +GT HL+ H + K ++RQ+LL Sbjct: 17 VWNHFERKVINGEQKAKCLHCNQLFSGNSKNGTSHLKDHLVLRCTKKHMKVDVRQKLLAV 76 Query: 231 NLNK-NHPELASYSFNHDA*KKELA 302 N + + L ++ FN + +KELA Sbjct: 77 NRRQDSSTRLENHVFNQEESRKELA 101 >KHN22193.1 Putative AC9 transposase, partial [Glycine soja] Length = 241 Score = 57.8 bits (138), Expect = 8e-08 Identities = 36/91 (39%), Positives = 49/91 (53%), Gaps = 5/91 (5%) Frame = +3 Query: 51 VWNHFVR-KKIDGVMKAVCKYCSKPLVGDLGSGTLHLRKH----FQNKHHNKTAGGNIRQ 215 VWNHF + K +DG KA CKYC L G +GT HL H Q + H+K G Q Sbjct: 3 VWNHFDKIKTVDGQDKAQCKYCKNFLGGAPKNGTKHLHAHMEKCIQKRLHDKGKG----Q 58 Query: 216 RLLLSNLNKNHPELASYSFNHDA*KKELAKA 308 L+ + + ELA+ S+N + +K+LA A Sbjct: 59 TFLIPKVTQGRQELAARSYNEENARKDLACA 89 >XP_016185489.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Arachis ipaensis] Length = 185 Score = 57.0 bits (136), Expect = 9e-08 Identities = 32/86 (37%), Positives = 47/86 (54%), Gaps = 2/86 (2%) Frame = +3 Query: 51 VWNHFVRKKIDGVMKAVCKYCSKPLVGDLGSGTLHLRKHFQNKHHNKTAGGNIRQRLLLS 230 VWNHF +I G +KA C YC L+GD GT HLR HF K + +IRQ ++ + Sbjct: 66 VWNHFKIVEIKGKLKAECNYCKSKLLGDPKQGTSHLRDHF--KSYKLRTTRDIRQCMMKT 123 Query: 231 NLNKNHPE--LASYSFNHDA*KKELA 302 + + +Y+FN + +KEL+ Sbjct: 124 TPTTSGKTVVVGAYTFNQENARKELS 149 >XP_017187384.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Malus domestica] Length = 488 Score = 58.2 bits (139), Expect = 1e-07 Identities = 32/87 (36%), Positives = 49/87 (56%), Gaps = 2/87 (2%) Frame = +3 Query: 51 VWNHFVRKKIDGVMKAVCKYCSKPLVGDLGSGTLHLRKHFQNKHHNKTAGGNIRQRLLLS 230 VW H+ R +DGVMKA+C YCSK L G+ +GT HLR H+ T RQ+ L Sbjct: 83 VWQHYTRTLVDGVMKAICNYCSKKLGGNTVNGTSHLR-------HHVTICPRRRQKKLKQ 135 Query: 231 NLNK--NHPELASYSFNHDA*KKELAK 305 L + ++ Y+F+ ++ ++ LA+ Sbjct: 136 TLTQKVGDGKVELYTFDQESARRALAQ 162 >XP_014634062.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] Length = 241 Score = 57.0 bits (136), Expect = 2e-07 Identities = 31/87 (35%), Positives = 44/87 (50%), Gaps = 1/87 (1%) Frame = +3 Query: 51 VWNHFVR-KKIDGVMKAVCKYCSKPLVGDLGSGTLHLRKHFQNKHHNKTAGGNIRQRLLL 227 VWNHF + K +DG KA CKYC K L G +GT HL H + + Q L+ Sbjct: 72 VWNHFDKIKTVDGQDKAQCKYCKKLLGGASNNGTKHLHAHMEKCIQKRLHDKGKEQTFLI 131 Query: 228 SNLNKNHPELASYSFNHDA*KKELAKA 308 + + EL + +N + +K+LA A Sbjct: 132 PKVTQGRQELTAGGYNEENARKDLACA 158 >XP_014629697.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] Length = 260 Score = 57.0 bits (136), Expect = 2e-07 Identities = 35/91 (38%), Positives = 48/91 (52%), Gaps = 5/91 (5%) Frame = +3 Query: 51 VWNHFVR-KKIDGVMKAVCKYCSKPLVGDLGSGTLHLRKH----FQNKHHNKTAGGNIRQ 215 VWNHF + K +DG KA CKYC K L G +GT HL H Q + H+K G Q Sbjct: 76 VWNHFDKIKTVDGQDKAQCKYCKKLLGGASKNGTKHLHAHMEKCIQKRLHDKGKG----Q 131 Query: 216 RLLLSNLNKNHPELASYSFNHDA*KKELAKA 308 L+ + + EL + +N + +K+LA A Sbjct: 132 TFLIPKVTQGRQELTAGGYNEENARKDLACA 162 >XP_014617524.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 4-like [Glycine max] Length = 183 Score = 55.8 bits (133), Expect = 2e-07 Identities = 35/91 (38%), Positives = 47/91 (51%), Gaps = 5/91 (5%) Frame = +3 Query: 51 VWNHFVR-KKIDGVMKAVCKYCSKPLVGDLGSGTLHLRKH----FQNKHHNKTAGGNIRQ 215 VWNHF + K +DG KA CKYC K L G +GT HL H Q + H+K G Q Sbjct: 72 VWNHFDKIKTVDGQDKAQCKYCKKLLGGASKNGTKHLHAHMEKCIQKRLHDKGKG----Q 127 Query: 216 RLLLSNLNKNHPELASYSFNHDA*KKELAKA 308 L+ + + EL +N + +K+LA A Sbjct: 128 TFLIPKVTQGRQELTVGGYNEENARKDLACA 158 >XP_014633991.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] Length = 260 Score = 56.6 bits (135), Expect = 2e-07 Identities = 36/91 (39%), Positives = 48/91 (52%), Gaps = 5/91 (5%) Frame = +3 Query: 51 VWNHFVRKKI-DGVMKAVCKYCSKPLVGDLGSGTLHLRKH----FQNKHHNKTAGGNIRQ 215 VWNHF + KI DG KA CKYC K L G +GT HL H Q + H+K G Q Sbjct: 76 VWNHFDKIKIVDGQDKAQCKYCKKLLGGASKNGTKHLHAHMEKCIQKRLHDKGKG----Q 131 Query: 216 RLLLSNLNKNHPELASYSFNHDA*KKELAKA 308 L+ + + EL + +N + +K+LA A Sbjct: 132 TFLIPKVTQGRQELTTGGYNEENARKDLACA 162