BLASTX nr result
ID: Angelica27_contig00038327
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00038327 (375 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017253005.1 PREDICTED: auxin response factor 5-like [Daucus c... 76 1e-13 4CHK_A Chain A, Crystal Structure Of The Arf5 Oligomerization Do... 70 5e-13 XP_019174662.1 PREDICTED: auxin response factor 5 isoform X2 [Ip... 74 7e-13 XP_019174661.1 PREDICTED: auxin response factor 5 isoform X1 [Ip... 74 7e-13 XP_017257770.1 PREDICTED: auxin response factor 5 [Daucus carota... 74 7e-13 XP_007160684.1 hypothetical protein PHAVU_001G008300g [Phaseolus... 69 1e-12 XP_016465083.1 PREDICTED: auxin response factor 5-like [Nicotian... 73 2e-12 XP_009778804.1 PREDICTED: auxin response factor 5 [Nicotiana syl... 73 2e-12 XP_019263965.1 PREDICTED: auxin response factor 5 [Nicotiana att... 73 2e-12 XP_006342026.1 PREDICTED: auxin response factor 5 [Solanum tuber... 73 2e-12 XP_015074004.1 PREDICTED: auxin response factor 5 [Solanum penne... 73 2e-12 NP_001234545.1 auxin response factor 5 [Solanum lycopersicum] AD... 73 2e-12 XP_016568464.1 PREDICTED: auxin response factor 5 [Capsicum annuum] 73 2e-12 XP_011083507.1 PREDICTED: auxin response factor 5 [Sesamum indicum] 73 2e-12 CDP07420.1 unnamed protein product [Coffea canephora] 73 2e-12 EYU38831.1 hypothetical protein MIMGU_mgv1a002956mg [Erythranthe... 72 2e-12 EPS64438.1 hypothetical protein M569_10340, partial [Genlisea au... 72 2e-12 XP_012839167.1 PREDICTED: auxin response factor 5-like [Erythran... 72 2e-12 XP_012835742.1 PREDICTED: auxin response factor 5 [Erythranthe g... 72 2e-12 XP_011074654.1 PREDICTED: auxin response factor 5-like [Sesamum ... 72 2e-12 >XP_017253005.1 PREDICTED: auxin response factor 5-like [Daucus carota subsp. sativus] Length = 926 Score = 75.9 bits (185), Expect = 1e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 374 VLLVGDDPWEEFVGCVRSIRILSPSEVQQMGEEGME 267 VLLVGDDPWEEFVGCVRSIRILSPSEVQQMGEEGM+ Sbjct: 881 VLLVGDDPWEEFVGCVRSIRILSPSEVQQMGEEGMQ 916 >4CHK_A Chain A, Crystal Structure Of The Arf5 Oligomerization Domain 4CHK_B Chain B, Crystal Structure Of The Arf5 Oligomerization Domain 4CHK_C Chain C, Crystal Structure Of The Arf5 Oligomerization Domain 4CHK_D Chain D, Crystal Structure Of The Arf5 Oligomerization Domain 4CHK_E Chain E, Crystal Structure Of The Arf5 Oligomerization Domain 4CHK_F Chain F, Crystal Structure Of The Arf5 Oligomerization Domain 4CHK_G Chain G, Crystal Structure Of The Arf5 Oligomerization Domain 4CHK_H Chain H, Crystal Structure Of The Arf5 Oligomerization Domain Length = 127 Score = 70.1 bits (170), Expect = 5e-13 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -2 Query: 374 VLLVGDDPWEEFVGCVRSIRILSPSEVQQMGEEGME 267 VLLVGDDPWEEFVGCVR IRILSP+EVQQM EEGM+ Sbjct: 77 VLLVGDDPWEEFVGCVRCIRILSPTEVQQMSEEGMK 112 >XP_019174662.1 PREDICTED: auxin response factor 5 isoform X2 [Ipomoea nil] Length = 894 Score = 73.9 bits (180), Expect = 7e-13 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 374 VLLVGDDPWEEFVGCVRSIRILSPSEVQQMGEEGME 267 VLLVGDDPWEEFVGCVR IRILSPSEVQQMGEEGM+ Sbjct: 839 VLLVGDDPWEEFVGCVRCIRILSPSEVQQMGEEGMQ 874 >XP_019174661.1 PREDICTED: auxin response factor 5 isoform X1 [Ipomoea nil] Length = 927 Score = 73.9 bits (180), Expect = 7e-13 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 374 VLLVGDDPWEEFVGCVRSIRILSPSEVQQMGEEGME 267 VLLVGDDPWEEFVGCVR IRILSPSEVQQMGEEGM+ Sbjct: 872 VLLVGDDPWEEFVGCVRCIRILSPSEVQQMGEEGMQ 907 >XP_017257770.1 PREDICTED: auxin response factor 5 [Daucus carota subsp. sativus] KZM90198.1 hypothetical protein DCAR_022437 [Daucus carota subsp. sativus] Length = 939 Score = 73.9 bits (180), Expect = 7e-13 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 374 VLLVGDDPWEEFVGCVRSIRILSPSEVQQMGEEGME 267 VLLVGDDPWEEFVGCVR IRILSPSEVQQMGEEGM+ Sbjct: 886 VLLVGDDPWEEFVGCVRCIRILSPSEVQQMGEEGMQ 921 >XP_007160684.1 hypothetical protein PHAVU_001G008300g [Phaseolus vulgaris] ESW32678.1 hypothetical protein PHAVU_001G008300g [Phaseolus vulgaris] Length = 122 Score = 68.9 bits (167), Expect = 1e-12 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -2 Query: 374 VLLVGDDPWEEFVGCVRSIRILSPSEVQQMGEEGME 267 VLLVGDDPWEEFV CVR IRILSPSEVQQM EEGM+ Sbjct: 75 VLLVGDDPWEEFVSCVRCIRILSPSEVQQMSEEGMK 110 >XP_016465083.1 PREDICTED: auxin response factor 5-like [Nicotiana tabacum] XP_016465084.1 PREDICTED: auxin response factor 5-like [Nicotiana tabacum] Length = 926 Score = 72.8 bits (177), Expect = 2e-12 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 374 VLLVGDDPWEEFVGCVRSIRILSPSEVQQMGEEGME 267 VLLVGDDPWEEFVGCVR IRILSP+EVQQMGEEGM+ Sbjct: 872 VLLVGDDPWEEFVGCVRCIRILSPTEVQQMGEEGMQ 907 >XP_009778804.1 PREDICTED: auxin response factor 5 [Nicotiana sylvestris] XP_009778805.1 PREDICTED: auxin response factor 5 [Nicotiana sylvestris] XP_009778806.1 PREDICTED: auxin response factor 5 [Nicotiana sylvestris] Length = 926 Score = 72.8 bits (177), Expect = 2e-12 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 374 VLLVGDDPWEEFVGCVRSIRILSPSEVQQMGEEGME 267 VLLVGDDPWEEFVGCVR IRILSP+EVQQMGEEGM+ Sbjct: 872 VLLVGDDPWEEFVGCVRCIRILSPTEVQQMGEEGMQ 907 >XP_019263965.1 PREDICTED: auxin response factor 5 [Nicotiana attenuata] OIT36774.1 auxin response factor 5 [Nicotiana attenuata] Length = 927 Score = 72.8 bits (177), Expect = 2e-12 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 374 VLLVGDDPWEEFVGCVRSIRILSPSEVQQMGEEGME 267 VLLVGDDPWEEFVGCVR IRILSP+EVQQMGEEGM+ Sbjct: 873 VLLVGDDPWEEFVGCVRCIRILSPTEVQQMGEEGMQ 908 >XP_006342026.1 PREDICTED: auxin response factor 5 [Solanum tuberosum] Length = 929 Score = 72.8 bits (177), Expect = 2e-12 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 374 VLLVGDDPWEEFVGCVRSIRILSPSEVQQMGEEGME 267 VLLVGDDPWEEFVGCVR IRILSP+EVQQMGEEGM+ Sbjct: 875 VLLVGDDPWEEFVGCVRCIRILSPTEVQQMGEEGMQ 910 >XP_015074004.1 PREDICTED: auxin response factor 5 [Solanum pennellii] Length = 930 Score = 72.8 bits (177), Expect = 2e-12 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 374 VLLVGDDPWEEFVGCVRSIRILSPSEVQQMGEEGME 267 VLLVGDDPWEEFVGCVR IRILSP+EVQQMGEEGM+ Sbjct: 876 VLLVGDDPWEEFVGCVRCIRILSPTEVQQMGEEGMQ 911 >NP_001234545.1 auxin response factor 5 [Solanum lycopersicum] ADJ96592.1 auxin response factor 5 [Solanum lycopersicum] ADP06665.1 auxin response factor 5 [Solanum lycopersicum] Length = 930 Score = 72.8 bits (177), Expect = 2e-12 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 374 VLLVGDDPWEEFVGCVRSIRILSPSEVQQMGEEGME 267 VLLVGDDPWEEFVGCVR IRILSP+EVQQMGEEGM+ Sbjct: 876 VLLVGDDPWEEFVGCVRCIRILSPTEVQQMGEEGMQ 911 >XP_016568464.1 PREDICTED: auxin response factor 5 [Capsicum annuum] Length = 935 Score = 72.8 bits (177), Expect = 2e-12 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 374 VLLVGDDPWEEFVGCVRSIRILSPSEVQQMGEEGME 267 VLLVGDDPWEEFVGCVR IRILSP+EVQQMGEEGM+ Sbjct: 881 VLLVGDDPWEEFVGCVRCIRILSPTEVQQMGEEGMQ 916 >XP_011083507.1 PREDICTED: auxin response factor 5 [Sesamum indicum] Length = 937 Score = 72.8 bits (177), Expect = 2e-12 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 374 VLLVGDDPWEEFVGCVRSIRILSPSEVQQMGEEGME 267 VLLVGDDPWEEFVGCV+ IRILSPSEVQQMGEEGM+ Sbjct: 878 VLLVGDDPWEEFVGCVKCIRILSPSEVQQMGEEGMQ 913 >CDP07420.1 unnamed protein product [Coffea canephora] Length = 949 Score = 72.8 bits (177), Expect = 2e-12 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 374 VLLVGDDPWEEFVGCVRSIRILSPSEVQQMGEEGME 267 VLLVGDDPWEEFVGCV+ IRILSPSEVQQMGEEGM+ Sbjct: 898 VLLVGDDPWEEFVGCVKCIRILSPSEVQQMGEEGMQ 933 >EYU38831.1 hypothetical protein MIMGU_mgv1a002956mg [Erythranthe guttata] Length = 621 Score = 72.4 bits (176), Expect = 2e-12 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 374 VLLVGDDPWEEFVGCVRSIRILSPSEVQQMGEEGME 267 VLLVGDDPWEEFVGCV+ IRILSPSEV+QMGEEGME Sbjct: 579 VLLVGDDPWEEFVGCVKCIRILSPSEVKQMGEEGME 614 >EPS64438.1 hypothetical protein M569_10340, partial [Genlisea aurea] Length = 720 Score = 72.4 bits (176), Expect = 2e-12 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 374 VLLVGDDPWEEFVGCVRSIRILSPSEVQQMGEEGME 267 VLLVGDDPWEEFVGCVR IRILSPSEV+QMGEEGM+ Sbjct: 675 VLLVGDDPWEEFVGCVRCIRILSPSEVRQMGEEGMQ 710 >XP_012839167.1 PREDICTED: auxin response factor 5-like [Erythranthe guttata] EYU36774.1 hypothetical protein MIMGU_mgv1a001550mg [Erythranthe guttata] Length = 798 Score = 72.4 bits (176), Expect = 2e-12 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 374 VLLVGDDPWEEFVGCVRSIRILSPSEVQQMGEEGME 267 VLLVGDDPWEEFVGCVR IRILSPSEV+QMGEEGM+ Sbjct: 756 VLLVGDDPWEEFVGCVRCIRILSPSEVKQMGEEGMQ 791 >XP_012835742.1 PREDICTED: auxin response factor 5 [Erythranthe guttata] Length = 825 Score = 72.4 bits (176), Expect = 2e-12 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 374 VLLVGDDPWEEFVGCVRSIRILSPSEVQQMGEEGME 267 VLLVGDDPWEEFVGCV+ IRILSPSEV+QMGEEGME Sbjct: 783 VLLVGDDPWEEFVGCVKCIRILSPSEVKQMGEEGME 818 >XP_011074654.1 PREDICTED: auxin response factor 5-like [Sesamum indicum] XP_011074655.1 PREDICTED: auxin response factor 5-like [Sesamum indicum] XP_011074656.1 PREDICTED: auxin response factor 5-like [Sesamum indicum] XP_011074657.1 PREDICTED: auxin response factor 5-like [Sesamum indicum] Length = 1012 Score = 72.4 bits (176), Expect = 2e-12 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 374 VLLVGDDPWEEFVGCVRSIRILSPSEVQQMGEEGME 267 VLLVGDDPWEEFVGCVR IRILSPSEV+QMGEEGM+ Sbjct: 952 VLLVGDDPWEEFVGCVRCIRILSPSEVKQMGEEGMQ 987