BLASTX nr result
ID: Angelica27_contig00038286
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00038286 (307 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017249470.1 PREDICTED: uncharacterized protein LOC108220264 [... 55 9e-07 >XP_017249470.1 PREDICTED: uncharacterized protein LOC108220264 [Daucus carota subsp. sativus] KZM94886.1 hypothetical protein DCAR_018128 [Daucus carota subsp. sativus] Length = 478 Score = 55.5 bits (132), Expect = 9e-07 Identities = 27/35 (77%), Positives = 28/35 (80%), Gaps = 1/35 (2%) Frame = -1 Query: 307 VGLNYIWRFEREMNAKVLVQCNN-NGFLALHNGAS 206 VGLNYIWRFEREMNAK L QC+N NGFL L AS Sbjct: 444 VGLNYIWRFEREMNAKALFQCSNLNGFLKLQTDAS 478