BLASTX nr result
ID: Angelica27_contig00038250
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00038250 (290 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017224728.1 PREDICTED: peroxidase 43 [Daucus carota subsp. sa... 73 3e-13 >XP_017224728.1 PREDICTED: peroxidase 43 [Daucus carota subsp. sativus] Length = 332 Score = 73.2 bits (178), Expect = 3e-13 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = -3 Query: 183 NNNKLVYYYQIMLALSIIFSCFLGVSQGQLMFGFYSNSCPNA 58 N KL YY+ IMLALSI+FSCF G SQGQLMFGFYSNSCPNA Sbjct: 3 NCGKLNYYHIIMLALSIVFSCFFGFSQGQLMFGFYSNSCPNA 44