BLASTX nr result
ID: Angelica27_contig00037988
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00037988 (239 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABK21521.1 unknown [Picea sitchensis] ABK25334.1 unknown [Picea ... 109 4e-29 ACN40757.1 unknown [Picea sitchensis] 108 6e-29 XP_010265834.1 PREDICTED: thioredoxin-like protein Clot [Nelumbo... 104 5e-27 KRH43474.1 hypothetical protein GLYMA_08G152300 [Glycine max] 98 5e-25 XP_014500437.1 PREDICTED: thioredoxin-like protein Clot [Vigna r... 99 6e-25 XP_014501338.1 PREDICTED: thioredoxin-like protein Clot [Vigna r... 98 1e-24 CDP07714.1 unnamed protein product [Coffea canephora] 98 1e-24 XP_017424269.1 PREDICTED: thioredoxin-like protein Clot [Vigna a... 98 2e-24 XP_007149056.1 hypothetical protein PHAVU_005G037200g [Phaseolus... 98 2e-24 NP_001239644.1 uncharacterized protein LOC100785157 [Glycine max... 98 2e-24 KHN29206.1 Thioredoxin-like protein Clot [Glycine soja] 98 2e-24 XP_019186981.1 PREDICTED: thioredoxin-like protein Clot [Ipomoea... 97 3e-24 XP_017423063.1 PREDICTED: thioredoxin-like protein Clot [Vigna a... 97 4e-24 OAY84845.1 Thioredoxin-like protein Clot [Ananas comosus] 97 6e-24 XP_010095387.1 hypothetical protein L484_013059 [Morus notabilis... 96 6e-24 XP_009394997.1 PREDICTED: thioredoxin-like protein Clot [Musa ac... 96 8e-24 EPS73999.1 hypothetical protein M569_00758 [Genlisea aurea] 96 9e-24 XP_007218586.1 hypothetical protein PRUPE_ppa013260mg [Prunus pe... 96 9e-24 XP_010910629.2 PREDICTED: thioredoxin-like protein Clot [Elaeis ... 97 1e-23 XP_011035028.1 PREDICTED: thioredoxin-like protein Clot [Populus... 96 1e-23 >ABK21521.1 unknown [Picea sitchensis] ABK25334.1 unknown [Picea sitchensis] ACN40908.1 unknown [Picea sitchensis] ACN41043.1 unknown [Picea sitchensis] Length = 130 Score = 109 bits (272), Expect = 4e-29 Identities = 46/59 (77%), Positives = 55/59 (93%) Frame = +2 Query: 2 RGFAGDRPTWRNPSHPWRLDDRFKLKGLPTLIRWKDGTISGRLEDHEAHIQSRINSLFE 178 R FAG+RPTWRNPSHPWR+D+RF+LKGLPTLIRW+DG I+GRLED+EAHI+SRI+ L E Sbjct: 72 RAFAGNRPTWRNPSHPWRVDERFRLKGLPTLIRWRDGAIAGRLEDNEAHIESRISKLLE 130 >ACN40757.1 unknown [Picea sitchensis] Length = 130 Score = 108 bits (271), Expect = 6e-29 Identities = 46/59 (77%), Positives = 55/59 (93%) Frame = +2 Query: 2 RGFAGDRPTWRNPSHPWRLDDRFKLKGLPTLIRWKDGTISGRLEDHEAHIQSRINSLFE 178 R FAG+RPTWRNPSHPWR+D+RF+LKGLPTLIRW+DG I+GRLED+EAHI+SRI+ L E Sbjct: 72 RAFAGNRPTWRNPSHPWRVDERFQLKGLPTLIRWRDGAIAGRLEDNEAHIESRISKLLE 130 >XP_010265834.1 PREDICTED: thioredoxin-like protein Clot [Nelumbo nucifera] Length = 140 Score = 104 bits (259), Expect = 5e-27 Identities = 41/56 (73%), Positives = 51/56 (91%) Frame = +2 Query: 2 RGFAGDRPTWRNPSHPWRLDDRFKLKGLPTLIRWKDGTISGRLEDHEAHIQSRINS 169 RGF GDRPTWRNP+HPWR+D RFKLKG+PTL+ W++G I+GRLEDHEAH++ +INS Sbjct: 72 RGFVGDRPTWRNPNHPWRVDSRFKLKGVPTLVSWENGAITGRLEDHEAHVEHKINS 127 >KRH43474.1 hypothetical protein GLYMA_08G152300 [Glycine max] Length = 106 Score = 98.2 bits (243), Expect = 5e-25 Identities = 39/57 (68%), Positives = 48/57 (84%) Frame = +2 Query: 2 RGFAGDRPTWRNPSHPWRLDDRFKLKGLPTLIRWKDGTISGRLEDHEAHIQSRINSL 172 R + GDRPTWRNP HPWR+D RFKL G+PTLIRW++ T+ G LEDHEAHI+S+I +L Sbjct: 46 RAYVGDRPTWRNPQHPWRMDPRFKLTGVPTLIRWENNTVKGHLEDHEAHIESKIEAL 102 >XP_014500437.1 PREDICTED: thioredoxin-like protein Clot [Vigna radiata var. radiata] Length = 132 Score = 99.0 bits (245), Expect = 6e-25 Identities = 39/57 (68%), Positives = 49/57 (85%) Frame = +2 Query: 2 RGFAGDRPTWRNPSHPWRLDDRFKLKGLPTLIRWKDGTISGRLEDHEAHIQSRINSL 172 R + GDRPTWRNP HPWR+D RFKL G+PTLIRW++ T+ GRLEDHEAH++S+I +L Sbjct: 72 RAYVGDRPTWRNPQHPWRVDPRFKLTGVPTLIRWENDTVKGRLEDHEAHVESKIEAL 128 >XP_014501338.1 PREDICTED: thioredoxin-like protein Clot [Vigna radiata var. radiata] Length = 131 Score = 98.2 bits (243), Expect = 1e-24 Identities = 38/59 (64%), Positives = 50/59 (84%) Frame = +2 Query: 2 RGFAGDRPTWRNPSHPWRLDDRFKLKGLPTLIRWKDGTISGRLEDHEAHIQSRINSLFE 178 R + GDRPTWRNP HPWR++ +FKL G+PTLIRW + T+ GRLEDHEAH++++I +LFE Sbjct: 72 RAYVGDRPTWRNPKHPWRVEPKFKLTGVPTLIRWDNDTVKGRLEDHEAHLENKIETLFE 130 >CDP07714.1 unnamed protein product [Coffea canephora] Length = 132 Score = 98.2 bits (243), Expect = 1e-24 Identities = 38/57 (66%), Positives = 49/57 (85%) Frame = +2 Query: 2 RGFAGDRPTWRNPSHPWRLDDRFKLKGLPTLIRWKDGTISGRLEDHEAHIQSRINSL 172 R + GDRPTWRNP HPWR+D FKL+G+PTL+RW++G I GRLEDHEAHI+ +I++L Sbjct: 72 RAYVGDRPTWRNPQHPWRVDSTFKLRGVPTLVRWENGAIKGRLEDHEAHIEQKIDAL 128 >XP_017424269.1 PREDICTED: thioredoxin-like protein Clot [Vigna angularis] KOM42874.1 hypothetical protein LR48_Vigan05g047800 [Vigna angularis] BAT93012.1 hypothetical protein VIGAN_07189600 [Vigna angularis var. angularis] Length = 132 Score = 97.8 bits (242), Expect = 2e-24 Identities = 39/57 (68%), Positives = 49/57 (85%) Frame = +2 Query: 2 RGFAGDRPTWRNPSHPWRLDDRFKLKGLPTLIRWKDGTISGRLEDHEAHIQSRINSL 172 R + GDRPTWRNP HPWR+D RFKL G+PTLIRW++ T+ GRLEDHEAH++S+I +L Sbjct: 72 RVYVGDRPTWRNPQHPWRVDPRFKLTGVPTLIRWENDTVKGRLEDHEAHVESKIEAL 128 >XP_007149056.1 hypothetical protein PHAVU_005G037200g [Phaseolus vulgaris] ESW21050.1 hypothetical protein PHAVU_005G037200g [Phaseolus vulgaris] Length = 132 Score = 97.8 bits (242), Expect = 2e-24 Identities = 38/57 (66%), Positives = 49/57 (85%) Frame = +2 Query: 2 RGFAGDRPTWRNPSHPWRLDDRFKLKGLPTLIRWKDGTISGRLEDHEAHIQSRINSL 172 R + GDRPTWRNP HPWR+D RFKL G+PTLIRW++ T+ GRLEDHE+H++S+I +L Sbjct: 72 RAYVGDRPTWRNPHHPWRVDPRFKLTGVPTLIRWENNTVKGRLEDHESHVESKIEAL 128 >NP_001239644.1 uncharacterized protein LOC100785157 [Glycine max] ACU13745.1 unknown [Glycine max] ACU17879.1 unknown [Glycine max] KHN49027.1 Thioredoxin-like protein Clot [Glycine soja] KRH13905.1 hypothetical protein GLYMA_15G271700 [Glycine max] Length = 132 Score = 97.8 bits (242), Expect = 2e-24 Identities = 38/57 (66%), Positives = 49/57 (85%) Frame = +2 Query: 2 RGFAGDRPTWRNPSHPWRLDDRFKLKGLPTLIRWKDGTISGRLEDHEAHIQSRINSL 172 R + GDRPTWRNP HPWR+D RFKL G+PTLIRW++ T+ GRLEDHEAH++++I +L Sbjct: 72 RAYVGDRPTWRNPQHPWRVDPRFKLTGVPTLIRWENNTVKGRLEDHEAHLENKIEAL 128 >KHN29206.1 Thioredoxin-like protein Clot [Glycine soja] Length = 147 Score = 98.2 bits (243), Expect = 2e-24 Identities = 39/57 (68%), Positives = 48/57 (84%) Frame = +2 Query: 2 RGFAGDRPTWRNPSHPWRLDDRFKLKGLPTLIRWKDGTISGRLEDHEAHIQSRINSL 172 R + GDRPTWRNP HPWR+D RFKL G+PTLIRW++ T+ G LEDHEAHI+S+I +L Sbjct: 87 RAYVGDRPTWRNPQHPWRMDPRFKLTGVPTLIRWENNTVKGHLEDHEAHIESKIEAL 143 >XP_019186981.1 PREDICTED: thioredoxin-like protein Clot [Ipomoea nil] Length = 132 Score = 97.1 bits (240), Expect = 3e-24 Identities = 37/57 (64%), Positives = 48/57 (84%) Frame = +2 Query: 2 RGFAGDRPTWRNPSHPWRLDDRFKLKGLPTLIRWKDGTISGRLEDHEAHIQSRINSL 172 + + GDRPTWRNP HPWR+D F LKG+PTLIRW+DG + GRLEDHEAH++ +I++L Sbjct: 72 KAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAVKGRLEDHEAHLEHKIDNL 128 >XP_017423063.1 PREDICTED: thioredoxin-like protein Clot [Vigna angularis] KOM42866.1 hypothetical protein LR48_Vigan05g047000 [Vigna angularis] BAT93021.1 hypothetical protein VIGAN_07190600 [Vigna angularis var. angularis] Length = 131 Score = 96.7 bits (239), Expect = 4e-24 Identities = 38/59 (64%), Positives = 49/59 (83%) Frame = +2 Query: 2 RGFAGDRPTWRNPSHPWRLDDRFKLKGLPTLIRWKDGTISGRLEDHEAHIQSRINSLFE 178 R + GDRPTWRNP HPWR++ RFKL G+PTLIRW + T+ GRLEDHEAH++++I +L E Sbjct: 72 RAYVGDRPTWRNPKHPWRVEPRFKLTGVPTLIRWDNDTVKGRLEDHEAHLENKIETLVE 130 >OAY84845.1 Thioredoxin-like protein Clot [Ananas comosus] Length = 140 Score = 96.7 bits (239), Expect = 6e-24 Identities = 39/57 (68%), Positives = 49/57 (85%) Frame = +2 Query: 2 RGFAGDRPTWRNPSHPWRLDDRFKLKGLPTLIRWKDGTISGRLEDHEAHIQSRINSL 172 R + GDRPTWRNPSHPWR+D RFKL G+PTLIRW++ I+GRLEDHEAH+ +I++L Sbjct: 80 RAYVGDRPTWRNPSHPWRVDPRFKLTGVPTLIRWENEAIAGRLEDHEAHVADKIDAL 136 >XP_010095387.1 hypothetical protein L484_013059 [Morus notabilis] EXB59939.1 hypothetical protein L484_013059 [Morus notabilis] Length = 132 Score = 96.3 bits (238), Expect = 6e-24 Identities = 38/57 (66%), Positives = 48/57 (84%) Frame = +2 Query: 2 RGFAGDRPTWRNPSHPWRLDDRFKLKGLPTLIRWKDGTISGRLEDHEAHIQSRINSL 172 R + GDRPTWRNP HPWR+D RFKL G+PTLIRW++ I+GRLEDHEAH++ +I +L Sbjct: 72 RAYVGDRPTWRNPPHPWRVDSRFKLTGVPTLIRWENDAITGRLEDHEAHVEKKIEAL 128 >XP_009394997.1 PREDICTED: thioredoxin-like protein Clot [Musa acuminata subsp. malaccensis] Length = 139 Score = 96.3 bits (238), Expect = 8e-24 Identities = 39/57 (68%), Positives = 50/57 (87%) Frame = +2 Query: 2 RGFAGDRPTWRNPSHPWRLDDRFKLKGLPTLIRWKDGTISGRLEDHEAHIQSRINSL 172 R + GDRPTWRNPSHPWR+D RFKLKG+PTLIRW++ ++GRLED+EAHI +I+S+ Sbjct: 79 RAYVGDRPTWRNPSHPWRVDPRFKLKGVPTLIRWENEDVAGRLEDYEAHIGDKIDSI 135 >EPS73999.1 hypothetical protein M569_00758 [Genlisea aurea] Length = 130 Score = 95.9 bits (237), Expect = 9e-24 Identities = 38/57 (66%), Positives = 47/57 (82%) Frame = +2 Query: 2 RGFAGDRPTWRNPSHPWRLDDRFKLKGLPTLIRWKDGTISGRLEDHEAHIQSRINSL 172 + + GDRPTWR+P HPWR D FKL+G+PTLIRW+DG + RLEDHEAHI S+I+SL Sbjct: 72 KAYVGDRPTWRSPQHPWRTDSTFKLRGVPTLIRWEDGAVKARLEDHEAHIDSKIDSL 128 >XP_007218586.1 hypothetical protein PRUPE_ppa013260mg [Prunus persica] XP_008231331.1 PREDICTED: thioredoxin-like protein Clot [Prunus mume] ONI20288.1 hypothetical protein PRUPE_2G007200 [Prunus persica] ONI20289.1 hypothetical protein PRUPE_2G007200 [Prunus persica] Length = 132 Score = 95.9 bits (237), Expect = 9e-24 Identities = 38/57 (66%), Positives = 48/57 (84%) Frame = +2 Query: 2 RGFAGDRPTWRNPSHPWRLDDRFKLKGLPTLIRWKDGTISGRLEDHEAHIQSRINSL 172 R + GDRPTWRNP HPWR+D RFKL G+PTL RW++ I GRLEDHEAH++S+I++L Sbjct: 72 RAYVGDRPTWRNPVHPWRVDSRFKLTGVPTLFRWENDAIKGRLEDHEAHVESKIDAL 128 >XP_010910629.2 PREDICTED: thioredoxin-like protein Clot [Elaeis guineensis] Length = 164 Score = 96.7 bits (239), Expect = 1e-23 Identities = 39/57 (68%), Positives = 50/57 (87%) Frame = +2 Query: 2 RGFAGDRPTWRNPSHPWRLDDRFKLKGLPTLIRWKDGTISGRLEDHEAHIQSRINSL 172 RG+ GDRPTWRNPSHPWR+D RF+L+G+PTLIRW++ GRLEDHEAHI ++I++L Sbjct: 104 RGYVGDRPTWRNPSHPWRIDPRFRLRGVPTLIRWENEAAIGRLEDHEAHIGNKIDAL 160 >XP_011035028.1 PREDICTED: thioredoxin-like protein Clot [Populus euphratica] Length = 132 Score = 95.5 bits (236), Expect = 1e-23 Identities = 38/57 (66%), Positives = 48/57 (84%) Frame = +2 Query: 2 RGFAGDRPTWRNPSHPWRLDDRFKLKGLPTLIRWKDGTISGRLEDHEAHIQSRINSL 172 R + GDRPTWRNP HPWR+D RFKLKG+PTLI W++ I GRLED+EAH++ +IN+L Sbjct: 72 RAYVGDRPTWRNPQHPWRVDSRFKLKGVPTLISWENDAIKGRLEDYEAHLEHKINAL 128