BLASTX nr result
ID: Angelica27_contig00037901
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00037901 (270 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM92664.1 hypothetical protein DCAR_019971 [Daucus carota subsp... 69 1e-13 KZM92662.1 hypothetical protein DCAR_019973 [Daucus carota subsp... 62 1e-10 KZN00851.1 hypothetical protein DCAR_009605 [Daucus carota subsp... 60 5e-10 XP_018681610.1 PREDICTED: auxin-induced protein 6B-like [Musa ac... 60 9e-10 XP_010272893.1 PREDICTED: auxin-induced protein 6B-like [Nelumbo... 60 1e-09 KGN54862.1 SAUR family protein [Cucumis sativus] 60 1e-09 XP_010025710.2 PREDICTED: auxin-induced protein 6B-like [Eucalyp... 59 2e-09 XP_018808507.1 PREDICTED: auxin-induced protein 6B-like [Juglans... 59 2e-09 XP_017614837.1 PREDICTED: auxin-responsive protein SAUR32-like [... 59 2e-09 XP_016752663.1 PREDICTED: auxin-responsive protein SAUR32-like [... 59 2e-09 XP_012457998.1 PREDICTED: auxin-induced protein 6B-like [Gossypi... 59 2e-09 AFK42432.1 unknown [Lotus japonicus] AFK45903.1 unknown [Lotus j... 59 3e-09 XP_016718679.1 PREDICTED: auxin-induced protein 15A-like [Gossyp... 59 3e-09 KJB33338.1 hypothetical protein B456_006G007200 [Gossypium raimo... 59 3e-09 XP_019414597.1 PREDICTED: auxin-induced protein 6B-like [Lupinus... 58 5e-09 NP_001236702.1 uncharacterized protein LOC100306557 [Glycine max... 58 6e-09 OMO52018.1 Auxin responsive SAUR protein [Corchorus capsularis] 58 6e-09 XP_003532148.1 PREDICTED: auxin-responsive protein SAUR32-like [... 58 6e-09 OIT03335.1 auxin-responsive protein saur32 [Nicotiana attenuata] 57 9e-09 XP_002300214.1 hypothetical protein POPTR_0001s31380g [Populus t... 57 9e-09 >KZM92664.1 hypothetical protein DCAR_019971 [Daucus carota subsp. sativus] Length = 80 Score = 68.9 bits (167), Expect = 1e-13 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -2 Query: 269 EVYGYHISGPLRLPCSVDEFVQLRWQIERKDR 174 EVYGYHISGPLRLPCSVDEFV LRWQIERK+R Sbjct: 49 EVYGYHISGPLRLPCSVDEFVHLRWQIERKER 80 >KZM92662.1 hypothetical protein DCAR_019973 [Daucus carota subsp. sativus] Length = 97 Score = 62.0 bits (149), Expect = 1e-10 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 269 EVYGYHISGPLRLPCSVDEFVQLRWQIERK 180 EVYGYH+SGPL+LPCSVDEFV LRWQIE++ Sbjct: 44 EVYGYHVSGPLKLPCSVDEFVHLRWQIEKE 73 >KZN00851.1 hypothetical protein DCAR_009605 [Daucus carota subsp. sativus] Length = 100 Score = 60.5 bits (145), Expect = 5e-10 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -2 Query: 269 EVYGYHISGPLRLPCSVDEFVQLRWQIERK 180 EVYGYHISGPL+LPCSVDEF+ LRW+IE++ Sbjct: 49 EVYGYHISGPLKLPCSVDEFIHLRWRIEKE 78 >XP_018681610.1 PREDICTED: auxin-induced protein 6B-like [Musa acuminata subsp. malaccensis] Length = 124 Score = 60.5 bits (145), Expect = 9e-10 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = -2 Query: 269 EVYGYHISGPLRLPCSVDEFVQLRWQIERKDR*SRHYTIDH 147 EVYGYH SGPL+LPCSVD+F+ LRW IER+ H+ + H Sbjct: 77 EVYGYHSSGPLKLPCSVDDFLHLRWLIERESSHRSHHGVHH 117 >XP_010272893.1 PREDICTED: auxin-induced protein 6B-like [Nelumbo nucifera] Length = 113 Score = 59.7 bits (143), Expect = 1e-09 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = -2 Query: 269 EVYGYHISGPLRLPCSVDEFVQLRWQIERKDR*SRHYT 156 EVYGYH +GPLRLPCSVD+F+ LRW+IER+ H++ Sbjct: 66 EVYGYHSTGPLRLPCSVDDFLHLRWRIERESNSHHHHS 103 >KGN54862.1 SAUR family protein [Cucumis sativus] Length = 113 Score = 59.7 bits (143), Expect = 1e-09 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = -2 Query: 269 EVYGYHISGPLRLPCSVDEFVQLRWQIERK 180 E+YGYH +GPLRLPCSVD+F+QLRWQIE++ Sbjct: 51 EIYGYHANGPLRLPCSVDDFLQLRWQIEKE 80 >XP_010025710.2 PREDICTED: auxin-induced protein 6B-like [Eucalyptus grandis] Length = 103 Score = 59.3 bits (142), Expect = 2e-09 Identities = 24/41 (58%), Positives = 31/41 (75%) Frame = -2 Query: 269 EVYGYHISGPLRLPCSVDEFVQLRWQIERKDR*SRHYTIDH 147 E YGYH +GPLRLPCSVD+F+ LRW+IE++ S H+ H Sbjct: 45 EAYGYHANGPLRLPCSVDDFLHLRWRIEKESSGSHHHHNHH 85 >XP_018808507.1 PREDICTED: auxin-induced protein 6B-like [Juglans regia] Length = 103 Score = 58.9 bits (141), Expect = 2e-09 Identities = 24/41 (58%), Positives = 31/41 (75%) Frame = -2 Query: 269 EVYGYHISGPLRLPCSVDEFVQLRWQIERKDR*SRHYTIDH 147 EVYGYH +GPLRLPCSVD+F+ LRW+IE++ H+ H Sbjct: 51 EVYGYHTTGPLRLPCSVDDFLHLRWRIEKEPNHHHHHHQHH 91 >XP_017614837.1 PREDICTED: auxin-responsive protein SAUR32-like [Gossypium arboreum] Length = 103 Score = 58.9 bits (141), Expect = 2e-09 Identities = 24/44 (54%), Positives = 31/44 (70%) Frame = -2 Query: 269 EVYGYHISGPLRLPCSVDEFVQLRWQIERKDR*SRHYTIDHIRP 138 EVYGYH GPL+LPCSVD+F+ L+WQIE++ H+ H P Sbjct: 52 EVYGYHTKGPLKLPCSVDDFLNLKWQIEKESNHHHHHHHHHHLP 95 >XP_016752663.1 PREDICTED: auxin-responsive protein SAUR32-like [Gossypium hirsutum] Length = 103 Score = 58.9 bits (141), Expect = 2e-09 Identities = 24/44 (54%), Positives = 31/44 (70%) Frame = -2 Query: 269 EVYGYHISGPLRLPCSVDEFVQLRWQIERKDR*SRHYTIDHIRP 138 EVYGYH GPL+LPCSVD+F+ L+WQIE++ H+ H P Sbjct: 52 EVYGYHTKGPLKLPCSVDDFLNLKWQIEKESNYHHHHHHHHHLP 95 >XP_012457998.1 PREDICTED: auxin-induced protein 6B-like [Gossypium raimondii] XP_016723902.1 PREDICTED: auxin-responsive protein SAUR32-like [Gossypium hirsutum] KJB75321.1 hypothetical protein B456_012G037000 [Gossypium raimondii] Length = 103 Score = 58.9 bits (141), Expect = 2e-09 Identities = 24/44 (54%), Positives = 31/44 (70%) Frame = -2 Query: 269 EVYGYHISGPLRLPCSVDEFVQLRWQIERKDR*SRHYTIDHIRP 138 EVYGYH GPL+LPCSVD+F+ L+WQIE++ H+ H P Sbjct: 52 EVYGYHTKGPLKLPCSVDDFLNLKWQIEKESNYHHHHHHHHHLP 95 >AFK42432.1 unknown [Lotus japonicus] AFK45903.1 unknown [Lotus japonicus] Length = 97 Score = 58.5 bits (140), Expect = 3e-09 Identities = 24/44 (54%), Positives = 31/44 (70%) Frame = -2 Query: 269 EVYGYHISGPLRLPCSVDEFVQLRWQIERKDR*SRHYTIDHIRP 138 EVYGYH GPL+LPCS+D+F+ LRWQIE++ S H + P Sbjct: 46 EVYGYHTEGPLKLPCSLDDFLHLRWQIEKESSNSHHNNHHQLLP 89 >XP_016718679.1 PREDICTED: auxin-induced protein 15A-like [Gossypium hirsutum] Length = 106 Score = 58.5 bits (140), Expect = 3e-09 Identities = 23/41 (56%), Positives = 31/41 (75%) Frame = -2 Query: 269 EVYGYHISGPLRLPCSVDEFVQLRWQIERKDR*SRHYTIDH 147 EVYGYH++GPLRLPCS D+F+ L+W+IER+ H+ H Sbjct: 52 EVYGYHMTGPLRLPCSTDDFLSLKWRIERESNHHHHHHHHH 92 >KJB33338.1 hypothetical protein B456_006G007200 [Gossypium raimondii] Length = 106 Score = 58.5 bits (140), Expect = 3e-09 Identities = 23/41 (56%), Positives = 31/41 (75%) Frame = -2 Query: 269 EVYGYHISGPLRLPCSVDEFVQLRWQIERKDR*SRHYTIDH 147 EVYGYH++GPLRLPCS D+F+ L+W+IER+ H+ H Sbjct: 52 EVYGYHMTGPLRLPCSTDDFLNLKWRIERESNHHHHHHHHH 92 >XP_019414597.1 PREDICTED: auxin-induced protein 6B-like [Lupinus angustifolius] OIV98116.1 hypothetical protein TanjilG_25981 [Lupinus angustifolius] Length = 106 Score = 58.2 bits (139), Expect = 5e-09 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = -2 Query: 269 EVYGYHISGPLRLPCSVDEFVQLRWQIERKDR*SRHYTIDH 147 EVYGYH GPL+LPCSVD+F+ LRW+IE++ S HY +H Sbjct: 56 EVYGYHTDGPLKLPCSVDDFLHLRWRIEKE---SGHYRHNH 93 >NP_001236702.1 uncharacterized protein LOC100306557 [Glycine max] ACU14780.1 unknown [Glycine max] KHN17415.1 Auxin-induced protein 6B [Glycine soja] KRH59646.1 hypothetical protein GLYMA_05G196300 [Glycine max] Length = 101 Score = 57.8 bits (138), Expect = 6e-09 Identities = 23/41 (56%), Positives = 30/41 (73%) Frame = -2 Query: 269 EVYGYHISGPLRLPCSVDEFVQLRWQIERKDR*SRHYTIDH 147 EVYGYH GPL+LPCSVD+F+ LRW+IE++ H+ H Sbjct: 45 EVYGYHTEGPLKLPCSVDDFLHLRWRIEKESTTHHHHQHHH 85 >OMO52018.1 Auxin responsive SAUR protein [Corchorus capsularis] Length = 103 Score = 57.8 bits (138), Expect = 6e-09 Identities = 22/41 (53%), Positives = 31/41 (75%) Frame = -2 Query: 269 EVYGYHISGPLRLPCSVDEFVQLRWQIERKDR*SRHYTIDH 147 EVYGYH +GPLRLPCS+D+F+ L+W+IE++ H+ H Sbjct: 51 EVYGYHTAGPLRLPCSIDDFLNLKWRIEKESNHHNHHHNHH 91 >XP_003532148.1 PREDICTED: auxin-responsive protein SAUR32-like [Glycine max] KHN16921.1 Auxin-induced protein 6B [Glycine soja] KRH40994.1 hypothetical protein GLYMA_08G004100 [Glycine max] Length = 105 Score = 57.8 bits (138), Expect = 6e-09 Identities = 22/41 (53%), Positives = 31/41 (75%) Frame = -2 Query: 269 EVYGYHISGPLRLPCSVDEFVQLRWQIERKDR*SRHYTIDH 147 EVYGYH GPL+LPCSVD+F+ LRW+I+++ H+ +H Sbjct: 48 EVYGYHTEGPLKLPCSVDDFLHLRWRIQKESSTHHHHNHNH 88 >OIT03335.1 auxin-responsive protein saur32 [Nicotiana attenuata] Length = 103 Score = 57.4 bits (137), Expect = 9e-09 Identities = 22/37 (59%), Positives = 30/37 (81%) Frame = -2 Query: 269 EVYGYHISGPLRLPCSVDEFVQLRWQIERKDR*SRHY 159 +VYGYH GPL+LPCSVD+F+ +RWQIE++ S H+ Sbjct: 45 DVYGYHAVGPLKLPCSVDDFLHIRWQIEKEPNRSHHH 81 >XP_002300214.1 hypothetical protein POPTR_0001s31380g [Populus trichocarpa] EEE85019.1 hypothetical protein POPTR_0001s31380g [Populus trichocarpa] Length = 106 Score = 57.4 bits (137), Expect = 9e-09 Identities = 25/48 (52%), Positives = 35/48 (72%) Frame = -2 Query: 269 EVYGYHISGPLRLPCSVDEFVQLRWQIERKDR*SRHYTIDHIRPCPST 126 EVYGYH +GPLR+PCSVD+F+ LRW+IE++ H++ H PS+ Sbjct: 54 EVYGYHTTGPLRVPCSVDDFLHLRWRIEKESSHHSHHS-HHQHHLPSS 100