BLASTX nr result
ID: Angelica27_contig00037543
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00037543 (299 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017245041.1 PREDICTED: CASP-like protein 4C2 [Daucus carota s... 70 2e-12 >XP_017245041.1 PREDICTED: CASP-like protein 4C2 [Daucus carota subsp. sativus] KZM97458.1 hypothetical protein DCAR_015180 [Daucus carota subsp. sativus] Length = 202 Score = 69.7 bits (169), Expect = 2e-12 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 101 MRNGGEAEATTMRQQRGQFDNHYQNTPPHFHST 3 MRNGG AEA TMRQQRGQFDNHYQ+TPPHFHST Sbjct: 1 MRNGGGAEAATMRQQRGQFDNHYQHTPPHFHST 33