BLASTX nr result
ID: Angelica27_contig00035906
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00035906 (292 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017259167.1 PREDICTED: plant intracellular Ras-group-related ... 77 2e-14 KVH92115.1 Leucine-rich repeat-containing protein [Cynara cardun... 65 3e-10 KVI08719.1 hypothetical protein Ccrd_012903 [Cynara cardunculus ... 64 6e-10 XP_006467113.1 PREDICTED: plant intracellular Ras-group-related ... 64 8e-10 XP_006425245.1 hypothetical protein CICLE_v10025268mg [Citrus cl... 64 8e-10 XP_010266272.1 PREDICTED: plant intracellular Ras-group-related ... 64 1e-09 XP_002306417.2 leucine-rich repeat family protein [Populus trich... 63 2e-09 XP_011022129.1 PREDICTED: plant intracellular Ras-group-related ... 63 2e-09 XP_002276062.1 PREDICTED: plant intracellular Ras-group-related ... 61 7e-09 XP_017248514.1 PREDICTED: plant intracellular Ras-group-related ... 61 9e-09 XP_007046446.2 PREDICTED: plant intracellular Ras-group-related ... 61 9e-09 EOX90603.1 Plant intracellular ras group-related LRR 4 [Theobrom... 61 9e-09 KZM98338.1 hypothetical protein DCAR_014300 [Daucus carota subsp... 61 9e-09 XP_010270538.1 PREDICTED: plant intracellular Ras-group-related ... 60 2e-08 XP_012845071.1 PREDICTED: plant intracellular Ras-group-related ... 60 2e-08 XP_004287708.1 PREDICTED: plant intracellular Ras-group-related ... 59 3e-08 KYP78798.1 Malignant fibrous histiocytoma-amplified sequence 1 [... 59 4e-08 XP_010029559.1 PREDICTED: plant intracellular Ras-group-related ... 59 4e-08 XP_008392219.1 PREDICTED: plant intracellular Ras-group-related ... 59 4e-08 XP_018857715.1 PREDICTED: plant intracellular Ras-group-related ... 59 6e-08 >XP_017259167.1 PREDICTED: plant intracellular Ras-group-related LRR protein 4-like [Daucus carota subsp. sativus] KZN10339.1 hypothetical protein DCAR_002995 [Daucus carota subsp. sativus] Length = 571 Score = 77.0 bits (188), Expect = 2e-14 Identities = 35/45 (77%), Positives = 41/45 (91%) Frame = -3 Query: 137 MEKSCPKTVDEVVREIMTIHRSLPPRPGIEQVEAAKILIRNIESE 3 M+ SCPKTVDEV+ EIM IHRSLP RPG+E+VEAAKILIRN+E+E Sbjct: 1 MQTSCPKTVDEVIEEIMRIHRSLPARPGLEEVEAAKILIRNVENE 45 >KVH92115.1 Leucine-rich repeat-containing protein [Cynara cardunculus var. scolymus] Length = 496 Score = 65.1 bits (157), Expect = 3e-10 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = -3 Query: 131 KSCPKTVDEVVREIMTIHRSLPPRPGIEQVEAAKILIRNIESE 3 +S K+VDEVV EIM HRSLPPRPGIE VE AKILIRN +SE Sbjct: 2 ESSAKSVDEVVEEIMRTHRSLPPRPGIEDVEGAKILIRNADSE 44 >KVI08719.1 hypothetical protein Ccrd_012903 [Cynara cardunculus var. scolymus] Length = 564 Score = 64.3 bits (155), Expect = 6e-10 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -3 Query: 131 KSCPKTVDEVVREIMTIHRSLPPRPGIEQVEAAKILIRNIESE 3 +S K+VDEV+ EIM IHRSLPPRPGI+ VE A ILIRN+E+E Sbjct: 9 ESAAKSVDEVLEEIMRIHRSLPPRPGIDDVEGASILIRNLENE 51 >XP_006467113.1 PREDICTED: plant intracellular Ras-group-related LRR protein 4 [Citrus sinensis] KDO71560.1 hypothetical protein CISIN_1g008287mg [Citrus sinensis] Length = 571 Score = 63.9 bits (154), Expect = 8e-10 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = -3 Query: 131 KSCPKTVDEVVREIMTIHRSLPPRPGIEQVEAAKILIRNIESE 3 +SC +++DE V EIM IH+SLP RPGIE++EAAK LIRN+E E Sbjct: 2 ESCVQSIDEAVEEIMRIHKSLPERPGIEEIEAAKTLIRNVEKE 44 >XP_006425245.1 hypothetical protein CICLE_v10025268mg [Citrus clementina] ESR38485.1 hypothetical protein CICLE_v10025268mg [Citrus clementina] Length = 571 Score = 63.9 bits (154), Expect = 8e-10 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = -3 Query: 131 KSCPKTVDEVVREIMTIHRSLPPRPGIEQVEAAKILIRNIESE 3 +SC +++DE V EIM IH+SLP RPGIE++EAAK LIRN+E E Sbjct: 2 ESCVQSIDEAVEEIMRIHKSLPERPGIEEIEAAKTLIRNVEKE 44 >XP_010266272.1 PREDICTED: plant intracellular Ras-group-related LRR protein 4-like [Nelumbo nucifera] XP_019054385.1 PREDICTED: plant intracellular Ras-group-related LRR protein 4-like [Nelumbo nucifera] Length = 568 Score = 63.5 bits (153), Expect = 1e-09 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -3 Query: 128 SCPKTVDEVVREIMTIHRSLPPRPGIEQVEAAKILIRNIESE 3 S P++VDEVV EIM IHRSLP RPGI++VEAAK LIRN++ E Sbjct: 3 STPQSVDEVVEEIMRIHRSLPTRPGIDEVEAAKDLIRNVDKE 44 >XP_002306417.2 leucine-rich repeat family protein [Populus trichocarpa] EEE93413.2 leucine-rich repeat family protein [Populus trichocarpa] Length = 540 Score = 62.8 bits (151), Expect = 2e-09 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -3 Query: 137 MEKSCPKTVDEVVREIMTIHRSLPPRPGIEQVEAAKILIRNIESE 3 ME + K+VD+ V EIM IHRSLP RPGIE+VEAAK LIRN+E E Sbjct: 1 MEITNVKSVDQAVEEIMRIHRSLPTRPGIEEVEAAKTLIRNVEKE 45 >XP_011022129.1 PREDICTED: plant intracellular Ras-group-related LRR protein 4-like [Populus euphratica] XP_011022130.1 PREDICTED: plant intracellular Ras-group-related LRR protein 4-like [Populus euphratica] Length = 577 Score = 62.8 bits (151), Expect = 2e-09 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -3 Query: 137 MEKSCPKTVDEVVREIMTIHRSLPPRPGIEQVEAAKILIRNIESE 3 ME + K+VD+ V EIM IHRSLP RPGIE+VEAAK LIRN+E E Sbjct: 1 MEITNVKSVDQAVEEIMRIHRSLPTRPGIEEVEAAKTLIRNVEKE 45 >XP_002276062.1 PREDICTED: plant intracellular Ras-group-related LRR protein 4 [Vitis vinifera] CBI21582.3 unnamed protein product, partial [Vitis vinifera] Length = 557 Score = 61.2 bits (147), Expect = 7e-09 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = -3 Query: 131 KSCPKTVDEVVREIMTIHRSLPPRPGIEQVEAAKILIRNIESE 3 +S K+VD+VV EIM IHRSLP RPGI++VEAA+ LIRN+E E Sbjct: 2 ESSAKSVDDVVGEIMRIHRSLPTRPGIDEVEAARTLIRNVEKE 44 >XP_017248514.1 PREDICTED: plant intracellular Ras-group-related LRR protein 4-like [Daucus carota subsp. sativus] Length = 561 Score = 60.8 bits (146), Expect = 9e-09 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = -3 Query: 137 MEKSCPKTVDEVVREIMTIHRSLPPRPGIEQVEAAKILIRNIESE 3 M+ PK+VDEVV EI IH+SLP RPGIE+VEAA LIRN+E++ Sbjct: 1 MDLLSPKSVDEVVAEITRIHKSLPERPGIEEVEAATALIRNVEAD 45 >XP_007046446.2 PREDICTED: plant intracellular Ras-group-related LRR protein 4 [Theobroma cacao] Length = 564 Score = 60.8 bits (146), Expect = 9e-09 Identities = 30/46 (65%), Positives = 36/46 (78%), Gaps = 1/46 (2%) Frame = -3 Query: 137 MEKSCP-KTVDEVVREIMTIHRSLPPRPGIEQVEAAKILIRNIESE 3 M +SC + DE V EIM IHRSLPPRPGI++VEAA+ LIRN+E E Sbjct: 1 MVESCVVHSTDEAVEEIMRIHRSLPPRPGIDEVEAARALIRNVEKE 46 >EOX90603.1 Plant intracellular ras group-related LRR 4 [Theobroma cacao] Length = 564 Score = 60.8 bits (146), Expect = 9e-09 Identities = 30/46 (65%), Positives = 36/46 (78%), Gaps = 1/46 (2%) Frame = -3 Query: 137 MEKSCP-KTVDEVVREIMTIHRSLPPRPGIEQVEAAKILIRNIESE 3 M +SC + DE V EIM IHRSLPPRPGI++VEAA+ LIRN+E E Sbjct: 1 MVESCVVHSTDEAVEEIMRIHRSLPPRPGIDEVEAARALIRNVEKE 46 >KZM98338.1 hypothetical protein DCAR_014300 [Daucus carota subsp. sativus] Length = 576 Score = 60.8 bits (146), Expect = 9e-09 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = -3 Query: 137 MEKSCPKTVDEVVREIMTIHRSLPPRPGIEQVEAAKILIRNIESE 3 M+ PK+VDEVV EI IH+SLP RPGIE+VEAA LIRN+E++ Sbjct: 1 MDLLSPKSVDEVVAEITRIHKSLPERPGIEEVEAATALIRNVEAD 45 >XP_010270538.1 PREDICTED: plant intracellular Ras-group-related LRR protein 4-like [Nelumbo nucifera] XP_010270539.1 PREDICTED: plant intracellular Ras-group-related LRR protein 4-like [Nelumbo nucifera] XP_010270540.1 PREDICTED: plant intracellular Ras-group-related LRR protein 4-like [Nelumbo nucifera] Length = 560 Score = 60.1 bits (144), Expect = 2e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -3 Query: 119 KTVDEVVREIMTIHRSLPPRPGIEQVEAAKILIRNIESE 3 ++VDEVV EIM IHRSLP RPG+++VEAAK LIRN+E E Sbjct: 6 QSVDEVVEEIMRIHRSLPTRPGLDEVEAAKDLIRNVEKE 44 >XP_012845071.1 PREDICTED: plant intracellular Ras-group-related LRR protein 4 [Erythranthe guttata] Length = 565 Score = 59.7 bits (143), Expect = 2e-08 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = -3 Query: 128 SCPKTVDEVVREIMTIHRSLPPRPGIEQVEAAKILIRNIESE 3 S T D VV EIM +HRSLPPRPGIE+VEAA LIRN+E E Sbjct: 3 SSAMTTDGVVEEIMRLHRSLPPRPGIEEVEAADTLIRNVERE 44 >XP_004287708.1 PREDICTED: plant intracellular Ras-group-related LRR protein 4 [Fragaria vesca subsp. vesca] Length = 550 Score = 59.3 bits (142), Expect = 3e-08 Identities = 27/43 (62%), Positives = 36/43 (83%) Frame = -3 Query: 131 KSCPKTVDEVVREIMTIHRSLPPRPGIEQVEAAKILIRNIESE 3 +S ++VD+VV EIM IHRSLPPRP I++VEAAK LI+N++ E Sbjct: 2 ESTAESVDQVVAEIMRIHRSLPPRPAIDEVEAAKALIQNVDKE 44 >KYP78798.1 Malignant fibrous histiocytoma-amplified sequence 1 [Cajanus cajan] Length = 549 Score = 58.9 bits (141), Expect = 4e-08 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = -3 Query: 137 MEKSCPKTVDEVVREIMTIHRSLPPRPGIEQVEAAKILIRNIESE 3 M+ S ++VDEVV EIM +HRSLP RPGIE+VEAA+ +I N+E E Sbjct: 1 MDLSPGRSVDEVVEEIMRLHRSLPARPGIEEVEAARTVIANVERE 45 >XP_010029559.1 PREDICTED: plant intracellular Ras-group-related LRR protein 4 [Eucalyptus grandis] XP_010029560.1 PREDICTED: plant intracellular Ras-group-related LRR protein 4 [Eucalyptus grandis] KCW56477.1 hypothetical protein EUGRSUZ_I02205 [Eucalyptus grandis] Length = 562 Score = 58.9 bits (141), Expect = 4e-08 Identities = 30/45 (66%), Positives = 34/45 (75%) Frame = -3 Query: 137 MEKSCPKTVDEVVREIMTIHRSLPPRPGIEQVEAAKILIRNIESE 3 ME +VDEVV EIM IHRSLP RP I++VEAAK LIRN+E E Sbjct: 1 METPSLGSVDEVVAEIMGIHRSLPARPSIDEVEAAKTLIRNVEKE 45 >XP_008392219.1 PREDICTED: plant intracellular Ras-group-related LRR protein 4 [Malus domestica] Length = 580 Score = 58.9 bits (141), Expect = 4e-08 Identities = 26/43 (60%), Positives = 35/43 (81%) Frame = -3 Query: 137 MEKSCPKTVDEVVREIMTIHRSLPPRPGIEQVEAAKILIRNIE 9 ME + +TVD+VV+EIM IHRSLPPRP +++VE A L+RN+E Sbjct: 1 METTAFETVDQVVQEIMRIHRSLPPRPAVDEVEVAAALVRNVE 43 >XP_018857715.1 PREDICTED: plant intracellular Ras-group-related LRR protein 4-like [Juglans regia] XP_018857716.1 PREDICTED: plant intracellular Ras-group-related LRR protein 4-like [Juglans regia] XP_018857717.1 PREDICTED: plant intracellular Ras-group-related LRR protein 4-like [Juglans regia] Length = 556 Score = 58.5 bits (140), Expect = 6e-08 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -3 Query: 116 TVDEVVREIMTIHRSLPPRPGIEQVEAAKILIRNIESE 3 ++DEVV EIM IHRSLP RPG++++EAAK LIRN+E E Sbjct: 4 SIDEVVEEIMRIHRSLPSRPGLDELEAAKALIRNLEKE 41