BLASTX nr result
ID: Angelica27_contig00035792
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00035792 (242 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017222528.1 PREDICTED: squalene monooxygenase-like [Daucus ca... 65 2e-10 >XP_017222528.1 PREDICTED: squalene monooxygenase-like [Daucus carota subsp. sativus] KZM85691.1 hypothetical protein DCAR_026887 [Daucus carota subsp. sativus] Length = 549 Score = 65.1 bits (157), Expect = 2e-10 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +2 Query: 122 VEFWRTAKIDQFFVGEILAAVIGAVVLFSLFRKRANNNAS 241 VEFWRTAKIDQFF+GE+LA VIG +VL+S FRKR NN+S Sbjct: 16 VEFWRTAKIDQFFLGELLAFVIGFMVLYSFFRKREKNNSS 55