BLASTX nr result
ID: Angelica27_contig00035762
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00035762 (239 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017255374.1 PREDICTED: stem-specific protein TSJT1-like [Dauc... 63 4e-10 XP_017226514.1 PREDICTED: stem-specific protein TSJT1-like [Dauc... 57 6e-08 >XP_017255374.1 PREDICTED: stem-specific protein TSJT1-like [Daucus carota subsp. sativus] KZN11453.1 hypothetical protein DCAR_004109 [Daucus carota subsp. sativus] Length = 264 Score = 63.2 bits (152), Expect = 4e-10 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = -2 Query: 238 CGSNFKVDFYSETKTIQRVGSEANWSSIWGQEA*HM 131 CGSNFKVD YS+TK++ RVGSEANW+++WGQ+A H+ Sbjct: 229 CGSNFKVDVYSKTKSMPRVGSEANWAAVWGQQAEHL 264 >XP_017226514.1 PREDICTED: stem-specific protein TSJT1-like [Daucus carota subsp. sativus] KZN11430.1 hypothetical protein DCAR_004086 [Daucus carota subsp. sativus] Length = 262 Score = 57.4 bits (137), Expect = 6e-08 Identities = 25/34 (73%), Positives = 31/34 (91%), Gaps = 1/34 (2%) Frame = -2 Query: 238 CGSNFKVDFYSETKT-IQRVGSEANWSSIWGQEA 140 CGSNFKVD YS+TK+ + RVGSEANW+++WGQEA Sbjct: 229 CGSNFKVDVYSKTKSSMPRVGSEANWAAVWGQEA 262