BLASTX nr result
ID: Angelica27_contig00035744
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00035744 (305 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017253852.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 7e-08 >XP_017253852.1 PREDICTED: pentatricopeptide repeat-containing protein At2g19280 [Daucus carota subsp. sativus] XP_017253853.1 PREDICTED: pentatricopeptide repeat-containing protein At2g19280 [Daucus carota subsp. sativus] XP_017253854.1 PREDICTED: pentatricopeptide repeat-containing protein At2g19280 [Daucus carota subsp. sativus] XP_017253855.1 PREDICTED: pentatricopeptide repeat-containing protein At2g19280 [Daucus carota subsp. sativus] KZM95108.1 hypothetical protein DCAR_018350 [Daucus carota subsp. sativus] Length = 730 Score = 58.5 bits (140), Expect = 7e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 305 GYKKNRARNPVETAAFKVQQILQKYGFSTDV 213 GYKKNRAR+PVETA +KVQ+ILQKYG+STDV Sbjct: 695 GYKKNRARHPVETAVYKVQKILQKYGYSTDV 725