BLASTX nr result
ID: Angelica27_contig00035704
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00035704 (242 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017240893.1 PREDICTED: F-box protein At1g61340-like [Daucus c... 62 4e-10 >XP_017240893.1 PREDICTED: F-box protein At1g61340-like [Daucus carota subsp. sativus] KZN11482.1 hypothetical protein DCAR_004138 [Daucus carota subsp. sativus] Length = 165 Score = 62.0 bits (149), Expect = 4e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +2 Query: 140 MELGNDQDLGFGYISLSRSWSFGRKRVFLSNNLE 241 MEL N QDLGFGYISLSRSWSFGRKRVFLS+NLE Sbjct: 1 MELAN-QDLGFGYISLSRSWSFGRKRVFLSSNLE 33