BLASTX nr result
ID: Angelica27_contig00035702
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00035702 (278 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017255327.1 PREDICTED: auxilin-like protein 1 [Daucus carota ... 64 5e-10 >XP_017255327.1 PREDICTED: auxilin-like protein 1 [Daucus carota subsp. sativus] KZM90164.1 hypothetical protein DCAR_022471 [Daucus carota subsp. sativus] Length = 1209 Score = 64.3 bits (155), Expect = 5e-10 Identities = 45/90 (50%), Positives = 54/90 (60%) Frame = -1 Query: 272 ISVSTYIENDYVFAEGGNHCNEEAVKSRPAMSDAELRHVVIKMNIRAYSVPSVSSENEKV 93 ISV E + VF E + +E+AVK+ P +S+ E R VVI N A S VSSE EKV Sbjct: 811 ISVIVSAEKENVFKEAKINRDEKAVKNSPDISNGE-RDVVILKNFEASSGSVVSSEIEKV 869 Query: 92 IQVDEEMRARRNIQMNGKGLCNTVAAEEKE 3 IQVDEEM R N +NG C T+ EEKE Sbjct: 870 IQVDEEMTDRHNTHVNGDS-CKTI--EEKE 896