BLASTX nr result
ID: Angelica27_contig00035516
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00035516 (238 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_004891654.1 unnamed protein product (chloroplast) [Nicotiana ... 82 9e-19 YP_004891653.1 unnamed protein product (chloroplast) [Nicotiana ... 76 3e-16 YP_009040365.1 hypothetical protein [Hyoscyamus niger] AGU46513.... 76 4e-16 OMP12521.1 hypothetical protein COLO4_03082 [Corchorus olitorius... 55 1e-08 YP_002720156.1 ORF126 [Jatropha curcas] YP_002720173.1 ORF126 [J... 54 3e-07 >YP_004891654.1 unnamed protein product (chloroplast) [Nicotiana undulata] YP_004891683.1 unnamed protein product (chloroplast) [Nicotiana undulata] CAA77387.1 hypothetical protein (chloroplast) [Nicotiana tabacum] CAA77406.1 hypothetical protein (chloroplast) [Nicotiana tabacum] BAE46701.1 hypothetical protein (chloroplast) [Nicotiana sylvestris] BAE46731.1 hypothetical protein (chloroplast) [Nicotiana sylvestris] BAE48050.1 hypothetical protein (chloroplast) [Nicotiana tomentosiformis] BAE48080.1 hypothetical protein (chloroplast) [Nicotiana tomentosiformis] AEO95592.1 hypothetical protein (chloroplast) [Nicotiana undulata] AEO95640.1 hypothetical protein (chloroplast) [Nicotiana undulata] AEO95702.1 hypothetical protein [synthetic construct] AEO95748.1 hypothetical protein [synthetic construct] prf||1211235CD ORF 92 Length = 92 Score = 82.0 bits (201), Expect = 9e-19 Identities = 41/53 (77%), Positives = 42/53 (79%) Frame = +2 Query: 77 AP*NGLCNVLYLLGCGRAFYQRFLIYPCVIPVEAYTRGGGVQGGRFLSRPPHS 235 +P GLCNVLYLLG GRAFYQRFLIYPCVIPVEAYTRG G G L R PHS Sbjct: 4 SPIPGLCNVLYLLGYGRAFYQRFLIYPCVIPVEAYTRGVGA-GRTILKRTPHS 55 >YP_004891653.1 unnamed protein product (chloroplast) [Nicotiana undulata] YP_004891682.1 unnamed protein product (chloroplast) [Nicotiana undulata] CAA77388.1 hypothetical protein (chloroplast) [Nicotiana tabacum] CAA77405.1 hypothetical protein (chloroplast) [Nicotiana tabacum] BAE46700.1 hypothetical protein (chloroplast) [Nicotiana sylvestris] BAE46730.1 hypothetical protein (chloroplast) [Nicotiana sylvestris] BAE48049.1 hypothetical protein (chloroplast) [Nicotiana tomentosiformis] BAE48079.1 hypothetical protein (chloroplast) [Nicotiana tomentosiformis] AEO95591.1 hypothetical protein (chloroplast) [Nicotiana undulata] AEO95639.1 hypothetical protein (chloroplast) [Nicotiana undulata] AEO95701.1 hypothetical protein [synthetic construct] AEO95747.1 hypothetical protein [synthetic construct] prf||1211235CC ORF 115 Length = 115 Score = 76.3 bits (186), Expect = 3e-16 Identities = 39/49 (79%), Positives = 40/49 (81%) Frame = -3 Query: 233 NGGVCLKIVRPAPPPREYMLQQESHKGRLETSGKMPARNPADKVHYIVR 87 NG LK PPP EYMLQQESHKGRLETSGKMPARNPADKVHYIV+ Sbjct: 43 NGESALKSSALHPPP-EYMLQQESHKGRLETSGKMPARNPADKVHYIVQ 90 >YP_009040365.1 hypothetical protein [Hyoscyamus niger] AGU46513.1 hypothetical protein (plastid) [Hyoscyamus niger] Length = 115 Score = 75.9 bits (185), Expect = 4e-16 Identities = 39/48 (81%), Positives = 39/48 (81%) Frame = -3 Query: 233 NGGVCLKIVRPAPPPREYMLQQESHKGRLETSGKMPARNPADKVHYIV 90 NG LK PPP EYMLQQESHKGRLETSGKMPARNPADKVHYIV Sbjct: 43 NGESALKSSALHPPP-EYMLQQESHKGRLETSGKMPARNPADKVHYIV 89 >OMP12521.1 hypothetical protein COLO4_03082 [Corchorus olitorius] OMP13318.1 hypothetical protein COLO4_01892 [Corchorus olitorius] OMP13405.1 hypothetical protein COLO4_01742 [Corchorus olitorius] OMP13506.1 hypothetical protein COLO4_01535 [Corchorus olitorius] OMP13791.1 hypothetical protein COLO4_00944 [Corchorus olitorius] Length = 36 Score = 55.1 bits (131), Expect = 1e-08 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = -3 Query: 80 ELRSKIWKKQAFPRFYHPVNSVPLNP 3 ELRSKIWKKQ FP+ YHPVNSVPLNP Sbjct: 2 ELRSKIWKKQVFPQLYHPVNSVPLNP 27 >YP_002720156.1 ORF126 [Jatropha curcas] YP_002720173.1 ORF126 [Jatropha curcas] ACN72735.1 ORF126 (chloroplast) [Jatropha curcas] ACN72751.1 ORF126 (chloroplast) [Jatropha curcas] Length = 126 Score = 53.5 bits (127), Expect = 3e-07 Identities = 31/59 (52%), Positives = 35/59 (59%), Gaps = 5/59 (8%) Frame = -3 Query: 233 NGGVCLKIVRPAPPP-----REYMLQQESHKGRLETSGKMPARNPADKVHYIVRFRELR 72 NG LK PPP R Y ++ +ETSGKMPARNP DKVHYIVRFR+ R Sbjct: 2 NGESALKASALQPPPSICFNRNYTRVVDT----IETSGKMPARNPTDKVHYIVRFRDWR 56