BLASTX nr result
ID: Angelica27_contig00035059
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00035059 (226 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM93608.1 hypothetical protein DCAR_016853 [Daucus carota subsp... 108 5e-26 XP_017252508.1 PREDICTED: protein strawberry notch-like [Daucus ... 108 5e-26 EYU27598.1 hypothetical protein MIMGU_mgv1a025623mg, partial [Er... 94 1e-22 XP_019183427.1 PREDICTED: protein strawberry notch [Ipomoea nil] 94 1e-20 CDP19351.1 unnamed protein product [Coffea canephora] 94 1e-20 XP_012848711.1 PREDICTED: protein strawberry notch [Erythranthe ... 94 1e-20 XP_011095835.1 PREDICTED: protein strawberry notch isoform X2 [S... 92 3e-20 XP_011095834.1 PREDICTED: protein strawberry notch isoform X1 [S... 92 3e-20 KRH44825.1 hypothetical protein GLYMA_08G233800 [Glycine max] 86 1e-19 BAT89728.1 hypothetical protein VIGAN_06076300 [Vigna angularis ... 89 1e-19 XP_010092468.1 Protein strawberry notch [Morus notabilis] EXB512... 91 2e-19 XP_013445305.1 RING/FYVE/PHD zinc finger protein [Medicago trunc... 90 2e-19 EPS59304.1 hypothetical protein M569_15504, partial [Genlisea au... 87 3e-19 KOM49813.1 hypothetical protein LR48_Vigan08g064000 [Vigna angul... 89 4e-19 GAV64893.1 PHD domain-containing protein/Helicase_C_4 domain-con... 89 4e-19 XP_016456068.1 PREDICTED: protein strawberry notch homolog 2-lik... 87 5e-19 XP_017432983.1 PREDICTED: protein strawberry notch isoform X4 [V... 89 5e-19 XP_014490219.1 PREDICTED: protein strawberry notch isoform X3 [V... 89 5e-19 XP_019072693.1 PREDICTED: protein strawberry notch isoform X2 [V... 89 5e-19 XP_017432981.1 PREDICTED: protein strawberry notch isoform X2 [V... 89 5e-19 >KZM93608.1 hypothetical protein DCAR_016853 [Daucus carota subsp. sativus] Length = 1139 Score = 108 bits (271), Expect = 5e-26 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = +2 Query: 41 TAPAHGIDPTKIQLPCAHCKAILNVPHGLTRFNCPQCNFVLSVDLSKISR 190 +APAHGIDPTKIQLPCAHCKAILNVPHGLTRFNCPQCNFVLSVDLSKISR Sbjct: 60 SAPAHGIDPTKIQLPCAHCKAILNVPHGLTRFNCPQCNFVLSVDLSKISR 109 >XP_017252508.1 PREDICTED: protein strawberry notch-like [Daucus carota subsp. sativus] Length = 1248 Score = 108 bits (271), Expect = 5e-26 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = +2 Query: 41 TAPAHGIDPTKIQLPCAHCKAILNVPHGLTRFNCPQCNFVLSVDLSKISR 190 +APAHGIDPTKIQLPCAHCKAILNVPHGLTRFNCPQCNFVLSVDLSKISR Sbjct: 60 SAPAHGIDPTKIQLPCAHCKAILNVPHGLTRFNCPQCNFVLSVDLSKISR 109 >EYU27598.1 hypothetical protein MIMGU_mgv1a025623mg, partial [Erythranthe guttata] Length = 152 Score = 93.6 bits (231), Expect = 1e-22 Identities = 41/49 (83%), Positives = 47/49 (95%) Frame = +2 Query: 44 APAHGIDPTKIQLPCAHCKAILNVPHGLTRFNCPQCNFVLSVDLSKISR 190 APAHGIDPTKIQLPCA+CKAILNVPHGL+RFNCPQC+ L+VDLSKI++ Sbjct: 88 APAHGIDPTKIQLPCANCKAILNVPHGLSRFNCPQCHINLAVDLSKIAQ 136 >XP_019183427.1 PREDICTED: protein strawberry notch [Ipomoea nil] Length = 1264 Score = 94.0 bits (232), Expect = 1e-20 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = +2 Query: 44 APAHGIDPTKIQLPCAHCKAILNVPHGLTRFNCPQCNFVLSVDLSKISR 190 APAHGIDPTKIQLPCAHCKAILNVPHGLTRF+CPQC L+VDLSKI + Sbjct: 80 APAHGIDPTKIQLPCAHCKAILNVPHGLTRFSCPQCAVDLAVDLSKIKQ 128 >CDP19351.1 unnamed protein product [Coffea canephora] Length = 565 Score = 93.6 bits (231), Expect = 1e-20 Identities = 42/48 (87%), Positives = 44/48 (91%) Frame = +2 Query: 41 TAPAHGIDPTKIQLPCAHCKAILNVPHGLTRFNCPQCNFVLSVDLSKI 184 TA AHGIDPTKIQLPCAHCKAILNVPHGL+RFNCPQC L+VDLSKI Sbjct: 85 TAAAHGIDPTKIQLPCAHCKAILNVPHGLSRFNCPQCGVDLAVDLSKI 132 >XP_012848711.1 PREDICTED: protein strawberry notch [Erythranthe guttata] Length = 1264 Score = 93.6 bits (231), Expect = 1e-20 Identities = 41/49 (83%), Positives = 47/49 (95%) Frame = +2 Query: 44 APAHGIDPTKIQLPCAHCKAILNVPHGLTRFNCPQCNFVLSVDLSKISR 190 APAHGIDPTKIQLPCA+CKAILNVPHGL+RFNCPQC+ L+VDLSKI++ Sbjct: 88 APAHGIDPTKIQLPCANCKAILNVPHGLSRFNCPQCHINLAVDLSKIAQ 136 >XP_011095835.1 PREDICTED: protein strawberry notch isoform X2 [Sesamum indicum] Length = 1010 Score = 92.4 bits (228), Expect = 3e-20 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = +2 Query: 41 TAPAHGIDPTKIQLPCAHCKAILNVPHGLTRFNCPQCNFVLSVDLSKISR 190 +APAHGIDPTKIQLPCA+CKAILNVPHGL+RFNCPQC L+VDLSKI + Sbjct: 81 SAPAHGIDPTKIQLPCANCKAILNVPHGLSRFNCPQCLISLAVDLSKIGQ 130 >XP_011095834.1 PREDICTED: protein strawberry notch isoform X1 [Sesamum indicum] Length = 1255 Score = 92.4 bits (228), Expect = 3e-20 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = +2 Query: 41 TAPAHGIDPTKIQLPCAHCKAILNVPHGLTRFNCPQCNFVLSVDLSKISR 190 +APAHGIDPTKIQLPCA+CKAILNVPHGL+RFNCPQC L+VDLSKI + Sbjct: 81 SAPAHGIDPTKIQLPCANCKAILNVPHGLSRFNCPQCLISLAVDLSKIGQ 130 >KRH44825.1 hypothetical protein GLYMA_08G233800 [Glycine max] Length = 160 Score = 86.3 bits (212), Expect = 1e-19 Identities = 38/49 (77%), Positives = 42/49 (85%) Frame = +2 Query: 44 APAHGIDPTKIQLPCAHCKAILNVPHGLTRFNCPQCNFVLSVDLSKISR 190 APAHGIDPTKIQLPCA CKAILNVPHGL RF CPQC L+VD+SK+ + Sbjct: 91 APAHGIDPTKIQLPCASCKAILNVPHGLPRFACPQCGVDLAVDVSKVKQ 139 >BAT89728.1 hypothetical protein VIGAN_06076300 [Vigna angularis var. angularis] Length = 312 Score = 89.0 bits (219), Expect = 1e-19 Identities = 39/49 (79%), Positives = 43/49 (87%) Frame = +2 Query: 44 APAHGIDPTKIQLPCAHCKAILNVPHGLTRFNCPQCNFVLSVDLSKISR 190 APAHGIDPTKIQLPCA CKAILNVPHGL RF CPQCN L+VD+SK+ + Sbjct: 92 APAHGIDPTKIQLPCASCKAILNVPHGLARFACPQCNVDLAVDVSKVKQ 140 >XP_010092468.1 Protein strawberry notch [Morus notabilis] EXB51234.1 Protein strawberry notch [Morus notabilis] Length = 874 Score = 90.5 bits (223), Expect = 2e-19 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = +2 Query: 47 PAHGIDPTKIQLPCAHCKAILNVPHGLTRFNCPQCNFVLSVDLSKI 184 PAHGIDPTKIQLPCA+CKAILNVPHGLTRFNCPQC+ L+VD+SK+ Sbjct: 106 PAHGIDPTKIQLPCANCKAILNVPHGLTRFNCPQCSVDLAVDVSKL 151 >XP_013445305.1 RING/FYVE/PHD zinc finger protein [Medicago truncatula] KEH19331.1 RING/FYVE/PHD zinc finger protein [Medicago truncatula] Length = 1252 Score = 90.1 bits (222), Expect = 2e-19 Identities = 39/48 (81%), Positives = 44/48 (91%) Frame = +2 Query: 47 PAHGIDPTKIQLPCAHCKAILNVPHGLTRFNCPQCNFVLSVDLSKISR 190 PAHGIDPTKIQLPCA CKAILNVPHGL+RF+CPQCN L+VDLSK+ + Sbjct: 83 PAHGIDPTKIQLPCAKCKAILNVPHGLSRFSCPQCNVDLAVDLSKVKQ 130 >EPS59304.1 hypothetical protein M569_15504, partial [Genlisea aurea] Length = 262 Score = 87.4 bits (215), Expect = 3e-19 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = +2 Query: 44 APAHGIDPTKIQLPCAHCKAILNVPHGLTRFNCPQCNFVLSVDL 175 APAHGIDPTKIQLPCA+CKAILNVPHGL+RFNCPQC+ L++DL Sbjct: 64 APAHGIDPTKIQLPCANCKAILNVPHGLSRFNCPQCHVSLAIDL 107 >KOM49813.1 hypothetical protein LR48_Vigan08g064000 [Vigna angularis] Length = 427 Score = 89.0 bits (219), Expect = 4e-19 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = +2 Query: 44 APAHGIDPTKIQLPCAHCKAILNVPHGLTRFNCPQCNFVLSVDLSKIS 187 APAHGIDPTKIQLPCA CKAILNVPHGL RF CPQCN L+VD+SK++ Sbjct: 92 APAHGIDPTKIQLPCASCKAILNVPHGLARFACPQCNVDLAVDVSKVA 139 >GAV64893.1 PHD domain-containing protein/Helicase_C_4 domain-containing protein/AAA_34 domain-containing protein [Cephalotus follicularis] Length = 1272 Score = 89.4 bits (220), Expect = 4e-19 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 47 PAHGIDPTKIQLPCAHCKAILNVPHGLTRFNCPQCNFVLSVDLSKISR 190 PAHGIDPTKIQLPCAHCKAILNVPHGL+ F+CPQC L+VDLSK+ + Sbjct: 79 PAHGIDPTKIQLPCAHCKAILNVPHGLSHFSCPQCGVDLAVDLSKVKQ 126 >XP_016456068.1 PREDICTED: protein strawberry notch homolog 2-like [Nicotiana tabacum] Length = 276 Score = 87.0 bits (214), Expect = 5e-19 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 41 TAPAHGIDPTKIQLPCAHCKAILNVPHGLTRFNCPQCNFVLSVDLSKI 184 +A AHGIDPTKIQLPCAHCKAILNVPHGL+ F+CPQC L+VD+SKI Sbjct: 76 SALAHGIDPTKIQLPCAHCKAILNVPHGLSHFSCPQCGIDLAVDISKI 123 >XP_017432983.1 PREDICTED: protein strawberry notch isoform X4 [Vigna angularis] Length = 1036 Score = 89.0 bits (219), Expect = 5e-19 Identities = 39/49 (79%), Positives = 43/49 (87%) Frame = +2 Query: 44 APAHGIDPTKIQLPCAHCKAILNVPHGLTRFNCPQCNFVLSVDLSKISR 190 APAHGIDPTKIQLPCA CKAILNVPHGL RF CPQCN L+VD+SK+ + Sbjct: 92 APAHGIDPTKIQLPCASCKAILNVPHGLARFACPQCNVDLAVDVSKVKQ 140 >XP_014490219.1 PREDICTED: protein strawberry notch isoform X3 [Vigna radiata var. radiata] Length = 1038 Score = 89.0 bits (219), Expect = 5e-19 Identities = 39/49 (79%), Positives = 43/49 (87%) Frame = +2 Query: 44 APAHGIDPTKIQLPCAHCKAILNVPHGLTRFNCPQCNFVLSVDLSKISR 190 APAHGIDPTKIQLPCA CKAILNVPHGL RF CPQCN L+VD+SK+ + Sbjct: 94 APAHGIDPTKIQLPCASCKAILNVPHGLARFACPQCNVDLAVDVSKVKQ 142 >XP_019072693.1 PREDICTED: protein strawberry notch isoform X2 [Vitis vinifera] Length = 1066 Score = 89.0 bits (219), Expect = 5e-19 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 47 PAHGIDPTKIQLPCAHCKAILNVPHGLTRFNCPQCNFVLSVDLSKISR 190 PAHGIDPTKIQLPCAHCKAILNVPHGL+RF CPQC L+VD+SK+ + Sbjct: 71 PAHGIDPTKIQLPCAHCKAILNVPHGLSRFACPQCGIDLAVDVSKLKQ 118 >XP_017432981.1 PREDICTED: protein strawberry notch isoform X2 [Vigna angularis] Length = 1217 Score = 89.0 bits (219), Expect = 5e-19 Identities = 39/49 (79%), Positives = 43/49 (87%) Frame = +2 Query: 44 APAHGIDPTKIQLPCAHCKAILNVPHGLTRFNCPQCNFVLSVDLSKISR 190 APAHGIDPTKIQLPCA CKAILNVPHGL RF CPQCN L+VD+SK+ + Sbjct: 92 APAHGIDPTKIQLPCASCKAILNVPHGLARFACPQCNVDLAVDVSKVKQ 140