BLASTX nr result
ID: Angelica27_contig00033935
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00033935 (394 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN02709.1 hypothetical protein DCAR_011464 [Daucus carota subsp... 55 3e-07 XP_017242588.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase ... 55 4e-06 >KZN02709.1 hypothetical protein DCAR_011464 [Daucus carota subsp. sativus] Length = 95 Score = 54.7 bits (130), Expect = 3e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 1 SDSKVYRVSEEDVLAADASLLFYEKISEAPTE 96 SDSKVY VSEE+VLAA+ASLLFYEK SEAPTE Sbjct: 63 SDSKVYIVSEEEVLAANASLLFYEKNSEAPTE 94 >XP_017242588.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 27 isoform X1 [Daucus carota subsp. sativus] XP_017242589.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 27 isoform X1 [Daucus carota subsp. sativus] XP_017242590.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 27 isoform X1 [Daucus carota subsp. sativus] Length = 582 Score = 54.7 bits (130), Expect = 4e-06 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 1 SDSKVYRVSEEDVLAADASLLFYEKISEAPTE 96 SDSKVY VSEE+VLAA+ASLLFYEK SEAPTE Sbjct: 550 SDSKVYIVSEEEVLAANASLLFYEKNSEAPTE 581