BLASTX nr result
ID: Angelica27_contig00033933
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00033933 (251 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017233573.1 PREDICTED: uncharacterized protein LOC108207651 [... 60 1e-08 KZN06168.1 hypothetical protein DCAR_007005 [Daucus carota subsp... 60 1e-08 >XP_017233573.1 PREDICTED: uncharacterized protein LOC108207651 [Daucus carota subsp. sativus] Length = 380 Score = 60.1 bits (144), Expect = 1e-08 Identities = 31/49 (63%), Positives = 35/49 (71%) Frame = +1 Query: 76 MSKGYQFIRELSAEKDDFIIKA*IIRMWDATNPKTKLTMNKNLILLDEE 222 MS Q IR L+ EKDD IK +IRMWDA N TKL +N+NLILLDEE Sbjct: 1 MSNDNQLIRGLTMEKDDNSIKVRLIRMWDAINRNTKLIINRNLILLDEE 49 >KZN06168.1 hypothetical protein DCAR_007005 [Daucus carota subsp. sativus] Length = 459 Score = 60.1 bits (144), Expect = 1e-08 Identities = 31/49 (63%), Positives = 35/49 (71%) Frame = +1 Query: 76 MSKGYQFIRELSAEKDDFIIKA*IIRMWDATNPKTKLTMNKNLILLDEE 222 MS Q IR L+ EKDD IK +IRMWDA N TKL +N+NLILLDEE Sbjct: 1 MSNDNQLIRGLTMEKDDNSIKVRLIRMWDAINRNTKLIINRNLILLDEE 49