BLASTX nr result
ID: Angelica27_contig00033745
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00033745 (280 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017223332.1 PREDICTED: probably inactive leucine-rich repeat ... 80 1e-15 KZM83694.1 hypothetical protein DCAR_028884 [Daucus carota subsp... 80 1e-15 XP_017223331.1 PREDICTED: probably inactive leucine-rich repeat ... 80 1e-15 XP_017217875.1 PREDICTED: probably inactive leucine-rich repeat ... 79 5e-15 XP_004491002.1 PREDICTED: probable leucine-rich repeat receptor-... 59 4e-08 KNA24190.1 hypothetical protein SOVF_017460 [Spinacia oleracea] 56 5e-07 XP_011046802.1 PREDICTED: probably inactive leucine-rich repeat ... 56 5e-07 AQM53752.1 hypothetical protein 560952, partial [Populus pruinosa] 55 5e-07 AQM53711.1 hypothetical protein 560952, partial [Populus euphrat... 55 5e-07 AQM53728.1 hypothetical protein 560952, partial [Populus euphrat... 55 5e-07 AQM53720.1 hypothetical protein, partial [Populus euphratica] AQ... 55 5e-07 AQM53702.1 hypothetical protein 560952, partial [Populus euphrat... 55 5e-07 AQM53746.1 hypothetical protein 560952, partial [Populus pruinos... 55 5e-07 AQM53761.1 hypothetical protein 560952, partial [Populus pruinos... 55 5e-07 AGE33921.1 hypothetical protein, partial [Populus pruinosa] 55 5e-07 AGE33919.1 hypothetical protein, partial [Populus pruinosa] AGE3... 55 5e-07 AGE33915.1 hypothetical protein, partial [Populus pruinosa] AGE3... 55 5e-07 AGE33111.1 hypothetical protein, partial [Populus euphratica] AG... 55 5e-07 AGE33102.1 hypothetical protein, partial [Populus euphratica] AG... 55 5e-07 AJD77266.1 hypothetical protein, partial [Populus mexicana] 55 6e-07 >XP_017223332.1 PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase IMK2 isoform X2 [Daucus carota subsp. sativus] Length = 798 Score = 80.5 bits (197), Expect = 1e-15 Identities = 44/68 (64%), Positives = 45/68 (66%), Gaps = 1/68 (1%) Frame = +2 Query: 2 VSNNNLSGEVPSKLVDKFNSSSFVGNIQLCGF-XXXXXXXXXXXXXXXXXXXXXASNHRK 178 VSNNNLSGEVPSKL+DKFNSSSFVGNI LCGF ASNHRK Sbjct: 356 VSNNNLSGEVPSKLLDKFNSSSFVGNILLCGFSPSTQCPSPPPQQQSPPPSSSQASNHRK 415 Query: 179 SKGHKTKD 202 SKGHKTKD Sbjct: 416 SKGHKTKD 423 >KZM83694.1 hypothetical protein DCAR_028884 [Daucus carota subsp. sativus] Length = 805 Score = 80.5 bits (197), Expect = 1e-15 Identities = 44/68 (64%), Positives = 45/68 (66%), Gaps = 1/68 (1%) Frame = +2 Query: 2 VSNNNLSGEVPSKLVDKFNSSSFVGNIQLCGF-XXXXXXXXXXXXXXXXXXXXXASNHRK 178 VSNNNLSGEVPSKL+DKFNSSSFVGNI LCGF ASNHRK Sbjct: 363 VSNNNLSGEVPSKLLDKFNSSSFVGNILLCGFSPSTQCPSPPPQQQSPPPSSSQASNHRK 422 Query: 179 SKGHKTKD 202 SKGHKTKD Sbjct: 423 SKGHKTKD 430 >XP_017223331.1 PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase IMK2 isoform X1 [Daucus carota subsp. sativus] Length = 839 Score = 80.5 bits (197), Expect = 1e-15 Identities = 44/68 (64%), Positives = 45/68 (66%), Gaps = 1/68 (1%) Frame = +2 Query: 2 VSNNNLSGEVPSKLVDKFNSSSFVGNIQLCGF-XXXXXXXXXXXXXXXXXXXXXASNHRK 178 VSNNNLSGEVPSKL+DKFNSSSFVGNI LCGF ASNHRK Sbjct: 397 VSNNNLSGEVPSKLLDKFNSSSFVGNILLCGFSPSTQCPSPPPQQQSPPPSSSQASNHRK 456 Query: 179 SKGHKTKD 202 SKGHKTKD Sbjct: 457 SKGHKTKD 464 >XP_017217875.1 PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase IMK2 [Daucus carota subsp. sativus] KZM86863.1 hypothetical protein DCAR_023997 [Daucus carota subsp. sativus] Length = 826 Score = 78.6 bits (192), Expect = 5e-15 Identities = 41/67 (61%), Positives = 46/67 (68%) Frame = +2 Query: 2 VSNNNLSGEVPSKLVDKFNSSSFVGNIQLCGFXXXXXXXXXXXXXXXXXXXXXASNHRKS 181 VSNNNLSGEVPSKL+DKFNS+SFVGNIQLCGF A+NH+KS Sbjct: 392 VSNNNLSGEVPSKLLDKFNSTSFVGNIQLCGF-----SPTTHCPSPTPSSSSQATNHQKS 446 Query: 182 KGHKTKD 202 +GHKTKD Sbjct: 447 RGHKTKD 453 >XP_004491002.1 PREDICTED: probable leucine-rich repeat receptor-like protein kinase IMK3 isoform X1 [Cicer arietinum] XP_012568530.1 PREDICTED: probable leucine-rich repeat receptor-like protein kinase IMK3 isoform X2 [Cicer arietinum] Length = 832 Score = 58.9 bits (141), Expect = 4e-08 Identities = 33/67 (49%), Positives = 35/67 (52%) Frame = +2 Query: 2 VSNNNLSGEVPSKLVDKFNSSSFVGNIQLCGFXXXXXXXXXXXXXXXXXXXXXASNHRKS 181 VS NNLSG VP+ L KFNSSSFVGNIQLCG+ AS HR Sbjct: 387 VSQNNLSGPVPTLLAQKFNSSSFVGNIQLCGYSPSTPCPSPAPSEGHPAAPSEASKHRHH 446 Query: 182 KGHKTKD 202 K TKD Sbjct: 447 KKLGTKD 453 >KNA24190.1 hypothetical protein SOVF_017460 [Spinacia oleracea] Length = 784 Score = 55.8 bits (133), Expect = 5e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 2 VSNNNLSGEVPSKLVDKFNSSSFVGNIQLCGF 97 VS NNLSG VP+KL KFNSSSF+GN+QLCGF Sbjct: 347 VSYNNLSGSVPNKLSQKFNSSSFIGNLQLCGF 378 >XP_011046802.1 PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase IMK2 [Populus euphratica] Length = 825 Score = 55.8 bits (133), Expect = 5e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 2 VSNNNLSGEVPSKLVDKFNSSSFVGNIQLCGF 97 VS+NNLSG VPS L KFNSSSFVGN+QLCG+ Sbjct: 383 VSHNNLSGSVPSSLAKKFNSSSFVGNLQLCGY 414 >AQM53752.1 hypothetical protein 560952, partial [Populus pruinosa] Length = 190 Score = 54.7 bits (130), Expect = 5e-07 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +2 Query: 2 VSNNNLSGEVPSKLVDKFNSSSFVGNIQLCGF 97 VS NNLSG VPS L KFNSSSFVGN+QLCG+ Sbjct: 107 VSYNNLSGSVPSSLAKKFNSSSFVGNLQLCGY 138 >AQM53711.1 hypothetical protein 560952, partial [Populus euphratica] AQM53714.1 hypothetical protein 560952, partial [Populus euphratica] Length = 192 Score = 54.7 bits (130), Expect = 5e-07 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +2 Query: 2 VSNNNLSGEVPSKLVDKFNSSSFVGNIQLCGF 97 VS NNLSG VPS L KFNSSSFVGN+QLCG+ Sbjct: 107 VSYNNLSGSVPSSLAKKFNSSSFVGNLQLCGY 138 >AQM53728.1 hypothetical protein 560952, partial [Populus euphratica] AQM53734.1 hypothetical protein 560952, partial [Populus euphratica] AQM53741.1 hypothetical protein 560952, partial [Populus euphratica] AQM53743.1 hypothetical protein 560952, partial [Populus euphratica] Length = 193 Score = 54.7 bits (130), Expect = 5e-07 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +2 Query: 2 VSNNNLSGEVPSKLVDKFNSSSFVGNIQLCGF 97 VS NNLSG VPS L KFNSSSFVGN+QLCG+ Sbjct: 107 VSYNNLSGSVPSSLAKKFNSSSFVGNLQLCGY 138 >AQM53720.1 hypothetical protein, partial [Populus euphratica] AQM53721.1 hypothetical protein 560952, partial [Populus euphratica] Length = 193 Score = 54.7 bits (130), Expect = 5e-07 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +2 Query: 2 VSNNNLSGEVPSKLVDKFNSSSFVGNIQLCGF 97 VS NNLSG VPS L KFNSSSFVGN+QLCG+ Sbjct: 107 VSYNNLSGSVPSSLAKKFNSSSFVGNLQLCGY 138 >AQM53702.1 hypothetical protein 560952, partial [Populus euphratica] AQM53703.1 hypothetical protein 560952, partial [Populus euphratica] AQM53704.1 hypothetical protein 560952, partial [Populus euphratica] AQM53722.1 hypothetical protein 560952, partial [Populus euphratica] Length = 193 Score = 54.7 bits (130), Expect = 5e-07 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +2 Query: 2 VSNNNLSGEVPSKLVDKFNSSSFVGNIQLCGF 97 VS NNLSG VPS L KFNSSSFVGN+QLCG+ Sbjct: 107 VSYNNLSGSVPSSLAKKFNSSSFVGNLQLCGY 138 >AQM53746.1 hypothetical protein 560952, partial [Populus pruinosa] AQM53748.1 hypothetical protein 560952, partial [Populus pruinosa] AQM53749.1 hypothetical protein 560952, partial [Populus pruinosa] AQM53760.1 hypothetical protein 560952, partial [Populus pruinosa] AQM53771.1 hypothetical protein 560952, partial [Populus pruinosa] Length = 193 Score = 54.7 bits (130), Expect = 5e-07 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +2 Query: 2 VSNNNLSGEVPSKLVDKFNSSSFVGNIQLCGF 97 VS NNLSG VPS L KFNSSSFVGN+QLCG+ Sbjct: 107 VSYNNLSGSVPSSLAKKFNSSSFVGNLQLCGY 138 >AQM53761.1 hypothetical protein 560952, partial [Populus pruinosa] AQM53765.1 hypothetical protein 560952, partial [Populus pruinosa] Length = 193 Score = 54.7 bits (130), Expect = 5e-07 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +2 Query: 2 VSNNNLSGEVPSKLVDKFNSSSFVGNIQLCGF 97 VS NNLSG VPS L KFNSSSFVGN+QLCG+ Sbjct: 107 VSYNNLSGSVPSSLAKKFNSSSFVGNLQLCGY 138 >AGE33921.1 hypothetical protein, partial [Populus pruinosa] Length = 193 Score = 54.7 bits (130), Expect = 5e-07 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +2 Query: 2 VSNNNLSGEVPSKLVDKFNSSSFVGNIQLCGF 97 VS NNLSG VPS L KFNSSSFVGN+QLCG+ Sbjct: 107 VSYNNLSGSVPSSLAKKFNSSSFVGNLQLCGY 138 >AGE33919.1 hypothetical protein, partial [Populus pruinosa] AGE33936.1 hypothetical protein, partial [Populus pruinosa] AQM53750.1 hypothetical protein 560952, partial [Populus pruinosa] Length = 193 Score = 54.7 bits (130), Expect = 5e-07 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +2 Query: 2 VSNNNLSGEVPSKLVDKFNSSSFVGNIQLCGF 97 VS NNLSG VPS L KFNSSSFVGN+QLCG+ Sbjct: 107 VSYNNLSGSVPSSLAKKFNSSSFVGNLQLCGY 138 >AGE33915.1 hypothetical protein, partial [Populus pruinosa] AGE33917.1 hypothetical protein, partial [Populus pruinosa] Length = 193 Score = 54.7 bits (130), Expect = 5e-07 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +2 Query: 2 VSNNNLSGEVPSKLVDKFNSSSFVGNIQLCGF 97 VS NNLSG VPS L KFNSSSFVGN+QLCG+ Sbjct: 107 VSYNNLSGSVPSSLAKKFNSSSFVGNLQLCGY 138 >AGE33111.1 hypothetical protein, partial [Populus euphratica] AGE33113.1 hypothetical protein, partial [Populus euphratica] AGE33115.1 hypothetical protein, partial [Populus euphratica] Length = 193 Score = 54.7 bits (130), Expect = 5e-07 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +2 Query: 2 VSNNNLSGEVPSKLVDKFNSSSFVGNIQLCGF 97 VS NNLSG VPS L KFNSSSFVGN+QLCG+ Sbjct: 107 VSYNNLSGSVPSSLAKKFNSSSFVGNLQLCGY 138 >AGE33102.1 hypothetical protein, partial [Populus euphratica] AGE33103.1 hypothetical protein, partial [Populus euphratica] AGE33104.1 hypothetical protein, partial [Populus euphratica] AGE33105.1 hypothetical protein, partial [Populus euphratica] AGE33106.1 hypothetical protein, partial [Populus euphratica] AGE33107.1 hypothetical protein, partial [Populus euphratica] AGE33108.1 hypothetical protein, partial [Populus euphratica] AGE33109.1 hypothetical protein, partial [Populus euphratica] AGE33110.1 hypothetical protein, partial [Populus euphratica] AGE33112.1 hypothetical protein, partial [Populus euphratica] AGE33114.1 hypothetical protein, partial [Populus euphratica] AGE33116.1 hypothetical protein, partial [Populus euphratica] AGE33117.1 hypothetical protein, partial [Populus euphratica] AGE33118.1 hypothetical protein, partial [Populus euphratica] AGE33119.1 hypothetical protein, partial [Populus euphratica] AGE33120.1 hypothetical protein, partial [Populus euphratica] AGE33121.1 hypothetical protein, partial [Populus euphratica] AGE33122.1 hypothetical protein, partial [Populus euphratica] AGE33123.1 hypothetical protein, partial [Populus euphratica] AGE33124.1 hypothetical protein, partial [Populus euphratica] AGE33125.1 hypothetical protein, partial [Populus euphratica] AGE33126.1 hypothetical protein, partial [Populus euphratica] AGE33127.1 hypothetical protein, partial [Populus euphratica] AGE33128.1 hypothetical protein, partial [Populus euphratica] AGE33129.1 hypothetical protein, partial [Populus euphratica] AGE33130.1 hypothetical protein, partial [Populus euphratica] AGE33131.1 hypothetical protein, partial [Populus euphratica] AGE33132.1 hypothetical protein, partial [Populus euphratica] AGE33133.1 hypothetical protein, partial [Populus euphratica] AGE33134.1 hypothetical protein, partial [Populus euphratica] AGE33135.1 hypothetical protein, partial [Populus euphratica] AGE33136.1 hypothetical protein, partial [Populus euphratica] AGE33137.1 hypothetical protein, partial [Populus euphratica] AGE33138.1 hypothetical protein, partial [Populus euphratica] AGE33139.1 hypothetical protein, partial [Populus euphratica] AGE33140.1 hypothetical protein, partial [Populus euphratica] AGE33141.1 hypothetical protein, partial [Populus euphratica] AGE33908.1 hypothetical protein, partial [Populus pruinosa] AGE33909.1 hypothetical protein, partial [Populus pruinosa] AGE33910.1 hypothetical protein, partial [Populus pruinosa] AGE33911.1 hypothetical protein, partial [Populus pruinosa] AGE33912.1 hypothetical protein, partial [Populus pruinosa] AGE33913.1 hypothetical protein, partial [Populus pruinosa] AGE33914.1 hypothetical protein, partial [Populus pruinosa] AGE33916.1 hypothetical protein, partial [Populus pruinosa] AGE33923.1 hypothetical protein, partial [Populus pruinosa] AGE33925.1 hypothetical protein, partial [Populus pruinosa] AGE33927.1 hypothetical protein, partial [Populus pruinosa] AGE33929.1 hypothetical protein, partial [Populus pruinosa] AGE33931.1 hypothetical protein, partial [Populus pruinosa] AGE33933.1 hypothetical protein, partial [Populus pruinosa] AGE33934.1 hypothetical protein, partial [Populus pruinosa] AGE33935.1 hypothetical protein, partial [Populus pruinosa] AGE33937.1 hypothetical protein, partial [Populus pruinosa] AQM53705.1 hypothetical protein 560952, partial [Populus euphratica] AQM53706.1 hypothetical protein 560952, partial [Populus euphratica] AQM53707.1 hypothetical protein 560952, partial [Populus euphratica] AQM53708.1 hypothetical protein 560952, partial [Populus euphratica] AQM53709.1 hypothetical protein 560952, partial [Populus euphratica] AQM53710.1 hypothetical protein 560952, partial [Populus euphratica] AQM53712.1 hypothetical protein 560952, partial [Populus euphratica] AQM53713.1 hypothetical protein 560952, partial [Populus euphratica] AQM53715.1 hypothetical protein 560952, partial [Populus euphratica] AQM53716.1 hypothetical protein 560952, partial [Populus euphratica] AQM53717.1 hypothetical protein 560952, partial [Populus euphratica] AQM53718.1 hypothetical protein 560952, partial [Populus euphratica] AQM53719.1 hypothetical protein 560952, partial [Populus euphratica] AQM53723.1 hypothetical protein 560952, partial [Populus euphratica] AQM53724.1 hypothetical protein 560952, partial [Populus euphratica] AQM53725.1 hypothetical protein 560952, partial [Populus euphratica] AQM53726.1 hypothetical protein 560952, partial [Populus euphratica] AQM53727.1 hypothetical protein 560952, partial [Populus euphratica] AQM53729.1 hypothetical protein 560952, partial [Populus euphratica] AQM53730.1 hypothetical protein 560952, partial [Populus euphratica] AQM53731.1 hypothetical protein 560952, partial [Populus euphratica] AQM53732.1 hypothetical protein 560952, partial [Populus euphratica] AQM53733.1 hypothetical protein 560952, partial [Populus euphratica] AQM53735.1 hypothetical protein 560952, partial [Populus euphratica] AQM53736.1 hypothetical protein 560952, partial [Populus euphratica] AQM53737.1 hypothetical protein 560952, partial [Populus euphratica] AQM53738.1 hypothetical protein 560952, partial [Populus euphratica] AQM53739.1 hypothetical protein 560952, partial [Populus euphratica] AQM53740.1 hypothetical protein 560952, partial [Populus euphratica] AQM53742.1 hypothetical protein 560952, partial [Populus euphratica] AQM53744.1 hypothetical protein 560952, partial [Populus euphratica] AQM53745.1 hypothetical protein 560952, partial [Populus euphratica] AQM53766.1 hypothetical protein 560952, partial [Populus pruinosa] AQM53767.1 hypothetical protein 560952, partial [Populus pruinosa] AQM53769.1 hypothetical protein 560952, partial [Populus pruinosa] AQM53770.1 hypothetical protein 560952, partial [Populus pruinosa] AQM53772.1 hypothetical protein 560952, partial [Populus pruinosa] Length = 193 Score = 54.7 bits (130), Expect = 5e-07 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +2 Query: 2 VSNNNLSGEVPSKLVDKFNSSSFVGNIQLCGF 97 VS NNLSG VPS L KFNSSSFVGN+QLCG+ Sbjct: 107 VSYNNLSGSVPSSLAKKFNSSSFVGNLQLCGY 138 >AJD77266.1 hypothetical protein, partial [Populus mexicana] Length = 206 Score = 54.7 bits (130), Expect = 6e-07 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +2 Query: 2 VSNNNLSGEVPSKLVDKFNSSSFVGNIQLCGF 97 VS NNLSG VPS L KFNSSSFVGN+QLCG+ Sbjct: 113 VSYNNLSGSVPSSLAKKFNSSSFVGNLQLCGY 144