BLASTX nr result
ID: Angelica27_contig00033449
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00033449 (237 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017235351.1 PREDICTED: uncharacterized protein LOC108209115 [... 111 7e-27 KZN06842.1 hypothetical protein DCAR_007679 [Daucus carota subsp... 111 7e-27 XP_017227827.1 PREDICTED: uncharacterized protein LOC108203413 [... 67 2e-11 >XP_017235351.1 PREDICTED: uncharacterized protein LOC108209115 [Daucus carota subsp. sativus] XP_017235352.1 PREDICTED: uncharacterized protein LOC108209115 [Daucus carota subsp. sativus] Length = 1600 Score = 111 bits (278), Expect = 7e-27 Identities = 54/78 (69%), Positives = 61/78 (78%) Frame = +3 Query: 3 ECTLENIEVLEGRSKHITSDICESSFQGTKSFKNIVPFGLSKVGNRYVRQSLDNDARQPK 182 ECTLENI+V +GRSKHI+S +CE FQ NI+PFGLS G+RYVRQSL NDAR P Sbjct: 725 ECTLENIKVFKGRSKHISSGVCEPPFQ------NIIPFGLSDPGDRYVRQSLGNDARHPV 778 Query: 183 LPFSLSFSTAPPLFHHLH 236 LP +LSFS APPLFHHLH Sbjct: 779 LPLALSFSAAPPLFHHLH 796 >KZN06842.1 hypothetical protein DCAR_007679 [Daucus carota subsp. sativus] Length = 1622 Score = 111 bits (278), Expect = 7e-27 Identities = 54/78 (69%), Positives = 61/78 (78%) Frame = +3 Query: 3 ECTLENIEVLEGRSKHITSDICESSFQGTKSFKNIVPFGLSKVGNRYVRQSLDNDARQPK 182 ECTLENI+V +GRSKHI+S +CE FQ NI+PFGLS G+RYVRQSL NDAR P Sbjct: 725 ECTLENIKVFKGRSKHISSGVCEPPFQ------NIIPFGLSDPGDRYVRQSLGNDARHPV 778 Query: 183 LPFSLSFSTAPPLFHHLH 236 LP +LSFS APPLFHHLH Sbjct: 779 LPLALSFSAAPPLFHHLH 796 >XP_017227827.1 PREDICTED: uncharacterized protein LOC108203413 [Daucus carota subsp. sativus] KZN10412.1 hypothetical protein DCAR_003068 [Daucus carota subsp. sativus] Length = 1811 Score = 67.4 bits (163), Expect = 2e-11 Identities = 41/82 (50%), Positives = 49/82 (59%), Gaps = 4/82 (4%) Frame = +3 Query: 3 ECTLENIEVLEGRSK--HITSDICESSFQGT--KSFKNIVPFGLSKVGNRYVRQSLDNDA 170 ECTLENI+ E SK HI S +SSFQGT KSF++I+P GLSK G Q + Sbjct: 913 ECTLENIQAFESGSKQIHINSVSWQSSFQGTRRKSFQDIIPIGLSKTGKENRSQPPCCNV 972 Query: 171 RQPKLPFSLSFSTAPPLFHHLH 236 LP +LSFS AP +F LH Sbjct: 973 MHGILPLALSFSAAPLVFRSLH 994