BLASTX nr result
ID: Angelica27_contig00033416
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00033416 (257 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017232321.1 PREDICTED: B3 domain-containing protein Os03g0120... 75 6e-14 >XP_017232321.1 PREDICTED: B3 domain-containing protein Os03g0120900-like [Daucus carota subsp. sativus] XP_017232322.1 PREDICTED: B3 domain-containing protein Os03g0120900-like [Daucus carota subsp. sativus] XP_017232323.1 PREDICTED: B3 domain-containing protein Os03g0120900-like [Daucus carota subsp. sativus] XP_017232324.1 PREDICTED: B3 domain-containing protein Os03g0120900-like [Daucus carota subsp. sativus] KZN05735.1 hypothetical protein DCAR_006572 [Daucus carota subsp. sativus] Length = 444 Score = 75.1 bits (183), Expect = 6e-14 Identities = 37/50 (74%), Positives = 40/50 (80%) Frame = -1 Query: 230 MSNPYSTSSSNIPYVQLSPHXXXXXXXXTLHDLMNKGKLSMSFDRSEGNS 81 MSNPY TSSSNIPYVQLSP TLHDLMNKGK+SMSFDR+EG+S Sbjct: 395 MSNPYDTSSSNIPYVQLSPQTATTSTTSTLHDLMNKGKMSMSFDRNEGHS 444