BLASTX nr result
ID: Angelica27_contig00033406
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00033406 (276 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017233988.1 PREDICTED: protein FEZ [Daucus carota subsp. sati... 82 7e-17 KZN05458.1 hypothetical protein DCAR_006295 [Daucus carota subsp... 82 1e-16 >XP_017233988.1 PREDICTED: protein FEZ [Daucus carota subsp. sativus] Length = 273 Score = 82.0 bits (201), Expect = 7e-17 Identities = 40/50 (80%), Positives = 41/50 (82%) Frame = -2 Query: 275 EEEETMLLFLNDEAIEINKILESTLTNWCGELGSPVAHSQYLGPLFHTLT 126 EEEETML FL DEA EINKILEST+ NW GE SPV SQYLGPLFHTLT Sbjct: 224 EEEETMLSFLYDEATEINKILESTIINWYGEFESPVVQSQYLGPLFHTLT 273 >KZN05458.1 hypothetical protein DCAR_006295 [Daucus carota subsp. sativus] Length = 311 Score = 82.0 bits (201), Expect = 1e-16 Identities = 40/50 (80%), Positives = 41/50 (82%) Frame = -2 Query: 275 EEEETMLLFLNDEAIEINKILESTLTNWCGELGSPVAHSQYLGPLFHTLT 126 EEEETML FL DEA EINKILEST+ NW GE SPV SQYLGPLFHTLT Sbjct: 262 EEEETMLSFLYDEATEINKILESTIINWYGEFESPVVQSQYLGPLFHTLT 311