BLASTX nr result
ID: Angelica27_contig00033392
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00033392 (208 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CQB88219.1 Uncharacterised protein [Chlamydia trachomatis] 50 6e-10 AOE10331.1 hypothetical protein [uncultured bacterium] 50 1e-06 AOE09239.1 hypothetical protein [uncultured bacterium] 50 1e-06 AOE06582.1 hypothetical protein [uncultured bacterium] AOE07907.... 50 1e-06 AOE06116.1 hypothetical protein [uncultured bacterium] AOE08018.... 50 1e-06 AOE11097.1 hypothetical protein [uncultured bacterium] AOE14170.... 50 2e-06 AOE11735.1 hypothetical protein [uncultured bacterium] 49 3e-06 AOE12507.1 hypothetical protein [uncultured bacterium] 49 3e-06 AOE06238.1 hypothetical protein [uncultured bacterium] 49 5e-06 WP_027586134.1 hypothetical protein [Prolixibacter bellariivorans] 48 7e-06 >CQB88219.1 Uncharacterised protein [Chlamydia trachomatis] Length = 53 Score = 49.7 bits (117), Expect(2) = 6e-10 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = -2 Query: 78 NEVWSP*QLGCWLGSSHSFKECVTAH 1 NEV QLGCWLGSSHSFKECVTAH Sbjct: 28 NEVTMHRQLGCWLGSSHSFKECVTAH 53 Score = 41.2 bits (95), Expect(2) = 6e-10 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -3 Query: 158 VGAKVHAREEKNPDHRLRPRNPG*VKLTK 72 +GAKVH REEKNPDH LR RN V L + Sbjct: 1 MGAKVHVREEKNPDHLLRSRNDSSVDLNE 29 >AOE10331.1 hypothetical protein [uncultured bacterium] Length = 62 Score = 50.1 bits (118), Expect = 1e-06 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = -3 Query: 200 TNSECTQAKPGSEGVGAKVHAREEKNPDHRLRPRN 96 TNSEC + SEG+GAKVH RE KNPDH+LR +N Sbjct: 26 TNSECYKMIVCSEGMGAKVHVREGKNPDHQLRSQN 60 >AOE09239.1 hypothetical protein [uncultured bacterium] Length = 62 Score = 50.1 bits (118), Expect = 1e-06 Identities = 22/32 (68%), Positives = 25/32 (78%) Frame = -3 Query: 200 TNSECTQAKPGSEGVGAKVHAREEKNPDHRLR 105 TNSEC + SEG+GAKVH RE KNPDH+LR Sbjct: 26 TNSECLEMMCSSEGMGAKVHVREGKNPDHQLR 57 >AOE06582.1 hypothetical protein [uncultured bacterium] AOE07907.1 hypothetical protein [uncultured bacterium] Length = 66 Score = 50.1 bits (118), Expect = 1e-06 Identities = 23/35 (65%), Positives = 26/35 (74%) Frame = -3 Query: 200 TNSECTQAKPGSEGVGAKVHAREEKNPDHRLRPRN 96 TNSEC + SEG+GAKVH RE KNPDH+LR N Sbjct: 30 TNSECYKMLISSEGMGAKVHVREGKNPDHQLRSPN 64 >AOE06116.1 hypothetical protein [uncultured bacterium] AOE08018.1 hypothetical protein [uncultured bacterium] Length = 66 Score = 50.1 bits (118), Expect = 1e-06 Identities = 23/35 (65%), Positives = 26/35 (74%) Frame = -3 Query: 200 TNSECTQAKPGSEGVGAKVHAREEKNPDHRLRPRN 96 TNSEC + SEG+GAKVH RE KNPDH+LR N Sbjct: 30 TNSECYKMLISSEGMGAKVHVREGKNPDHQLRSPN 64 >AOE11097.1 hypothetical protein [uncultured bacterium] AOE14170.1 hypothetical protein [uncultured bacterium] Length = 66 Score = 49.7 bits (117), Expect = 2e-06 Identities = 23/35 (65%), Positives = 26/35 (74%) Frame = -3 Query: 200 TNSECTQAKPGSEGVGAKVHAREEKNPDHRLRPRN 96 TNSEC + SEG+GAKVH RE KNPDH+LR N Sbjct: 30 TNSECYKMFLSSEGMGAKVHVREGKNPDHQLRSPN 64 >AOE11735.1 hypothetical protein [uncultured bacterium] Length = 66 Score = 49.3 bits (116), Expect = 3e-06 Identities = 23/37 (62%), Positives = 26/37 (70%) Frame = -3 Query: 206 VQTNSECTQAKPGSEGVGAKVHAREEKNPDHRLRPRN 96 + +NSEC GSEG+GAKVH RE KNPDH LR N Sbjct: 28 ILSNSECYYLFHGSEGMGAKVHVREGKNPDHLLRSPN 64 >AOE12507.1 hypothetical protein [uncultured bacterium] Length = 62 Score = 48.9 bits (115), Expect = 3e-06 Identities = 22/32 (68%), Positives = 25/32 (78%) Frame = -3 Query: 200 TNSECTQAKPGSEGVGAKVHAREEKNPDHRLR 105 TNSEC + SEG+GAKVH RE KNPDH+LR Sbjct: 26 TNSECYKMLLSSEGMGAKVHVREGKNPDHQLR 57 >AOE06238.1 hypothetical protein [uncultured bacterium] Length = 62 Score = 48.5 bits (114), Expect = 5e-06 Identities = 22/32 (68%), Positives = 25/32 (78%) Frame = -3 Query: 200 TNSECTQAKPGSEGVGAKVHAREEKNPDHRLR 105 TNSEC + SEG+GAKVH RE KNPDH+LR Sbjct: 26 TNSECYRMIYSSEGMGAKVHVREGKNPDHQLR 57 >WP_027586134.1 hypothetical protein [Prolixibacter bellariivorans] Length = 66 Score = 48.1 bits (113), Expect = 7e-06 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = -3 Query: 206 VQTNSECTQAKPGSEGVGAKVHAREEKNPDHRLR 105 +QTNSEC + SEG GAKV RE KNPDH+LR Sbjct: 28 LQTNSECCKMLTRSEGAGAKVRVREGKNPDHQLR 61