BLASTX nr result
ID: Angelica27_contig00033163
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00033163 (341 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM82301.1 hypothetical protein DCAR_029799 [Daucus carota subsp... 57 5e-08 KZM80121.1 hypothetical protein DCAR_000259 [Daucus carota subsp... 55 3e-07 KZM94094.1 hypothetical protein DCAR_017339 [Daucus carota subsp... 57 5e-07 KZM94159.1 hypothetical protein DCAR_017404 [Daucus carota subsp... 55 1e-06 KZN08606.1 hypothetical protein DCAR_001136 [Daucus carota subsp... 51 9e-06 >KZM82301.1 hypothetical protein DCAR_029799 [Daucus carota subsp. sativus] Length = 115 Score = 56.6 bits (135), Expect = 5e-08 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = +3 Query: 3 EWKKSGKDYSTFQQKLVGPTGYKAFFMPTPGFVPF 107 EW+KSGK Y+ F++KL GPTGYKA FMPTPG F Sbjct: 50 EWEKSGKSYAEFREKLRGPTGYKAVFMPTPGHRKF 84 >KZM80121.1 hypothetical protein DCAR_000259 [Daucus carota subsp. sativus] KZM95295.1 hypothetical protein DCAR_018537 [Daucus carota subsp. sativus] Length = 142 Score = 55.1 bits (131), Expect = 3e-07 Identities = 22/35 (62%), Positives = 29/35 (82%) Frame = +3 Query: 3 EWKKSGKDYSTFQQKLVGPTGYKAFFMPTPGFVPF 107 +W++SG+DY+ FQQKL G G+KA FMPTPG +PF Sbjct: 10 DWQESGRDYAAFQQKLRGDIGFKAVFMPTPGQLPF 44 >KZM94094.1 hypothetical protein DCAR_017339 [Daucus carota subsp. sativus] Length = 947 Score = 56.6 bits (135), Expect = 5e-07 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +3 Query: 3 EWKKSGKDYSTFQQKLVGPTGYKAFFMPTPG 95 EW+KSGK+Y+ FQ++L GPTGYKA FMPTPG Sbjct: 878 EWEKSGKNYADFQEQLRGPTGYKAVFMPTPG 908 >KZM94159.1 hypothetical protein DCAR_017404 [Daucus carota subsp. sativus] Length = 282 Score = 55.1 bits (131), Expect = 1e-06 Identities = 22/35 (62%), Positives = 29/35 (82%) Frame = +3 Query: 3 EWKKSGKDYSTFQQKLVGPTGYKAFFMPTPGFVPF 107 +W++SG+DY+ FQQKL G G+KA FMPTPG +PF Sbjct: 150 DWQESGRDYAAFQQKLRGDIGFKAVFMPTPGQLPF 184 >KZN08606.1 hypothetical protein DCAR_001136 [Daucus carota subsp. sativus] Length = 119 Score = 50.8 bits (120), Expect = 9e-06 Identities = 21/34 (61%), Positives = 26/34 (76%) Frame = +3 Query: 9 KKSGKDYSTFQQKLVGPTGYKAFFMPTPGFVPFM 110 +K D+ FQ KL+GP G+KA FMPTPGFVPF+ Sbjct: 12 EKQVNDHRPFQDKLLGPLGFKAVFMPTPGFVPFL 45