BLASTX nr result
ID: Angelica27_contig00033032
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00033032 (388 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM88884.1 hypothetical protein DCAR_025959 [Daucus carota subsp... 132 2e-35 >KZM88884.1 hypothetical protein DCAR_025959 [Daucus carota subsp. sativus] Length = 273 Score = 132 bits (331), Expect = 2e-35 Identities = 66/101 (65%), Positives = 76/101 (75%) Frame = +1 Query: 82 MLASVPSLIKTKTVRTLFTELESCKQSEVPAWKLNFVSKNLILLNKCGRDRNKITTTHRK 261 M ASV SL K +VRTLF EL K S +PAWKL F+SKNL++L KCG DRNKI HRK Sbjct: 1 MFASVHSLTKINSVRTLFAELRFRKHSNLPAWKLAFISKNLMVLKKCGGDRNKIVMNHRK 60 Query: 262 ITGNERIKALRQHVFIEKSSAFRPLFATGGLESTINHLSKW 384 T NE I+AL QHVF++KS AFRP FA GG+EST+N LSKW Sbjct: 61 STVNEGIEALGQHVFVDKSFAFRPKFAAGGMESTLNLLSKW 101