BLASTX nr result
ID: Angelica27_contig00032932
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00032932 (321 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017247411.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 8e-14 >XP_017247411.1 PREDICTED: pentatricopeptide repeat-containing protein At5g12100, mitochondrial-like [Daucus carota subsp. sativus] KZM98682.1 hypothetical protein DCAR_013956 [Daucus carota subsp. sativus] Length = 810 Score = 58.5 bits (140), Expect(2) = 8e-14 Identities = 37/62 (59%), Positives = 43/62 (69%), Gaps = 5/62 (8%) Frame = +2 Query: 29 TQKMAQRIHFLRTKTSLGKSLCST---TQLPNLQSTVSVS--DEKLKQLLQTHLQNHNTS 193 TQ+M QR FL T+ SL +SLCST TQL NLQ VS E++K LLQTHLQNHNT+ Sbjct: 2 TQRMLQRSLFLNTRASLRRSLCSTTDPTQLQNLQPLVSDQHRHEQIK-LLQTHLQNHNTN 60 Query: 194 TA 199 A Sbjct: 61 KA 62 Score = 45.4 bits (106), Expect(2) = 8e-14 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 247 YSMFTHSSHSVKLTFSNLLLSVCAE 321 YSMFT SSH VKLTF NLLLSVCAE Sbjct: 83 YSMFTPSSHPVKLTFLNLLLSVCAE 107