BLASTX nr result
ID: Angelica27_contig00032765
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00032765 (215 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019151835.1 PREDICTED: endoglucanase 3-like [Ipomoea nil] 62 1e-09 XP_019155567.1 PREDICTED: endoglucanase 3-like isoform X2 [Ipomo... 61 3e-09 XP_019155566.1 PREDICTED: endoglucanase 3-like isoform X1 [Ipomo... 61 3e-09 XP_009603927.1 PREDICTED: endoglucanase 9-like [Nicotiana toment... 61 4e-09 AAL30452.1 endo-beta-1,4-glucanase precursor [Nicotiana tabacum] 61 4e-09 XP_019228899.1 PREDICTED: endoglucanase 9-like [Nicotiana attenu... 61 4e-09 XP_009788927.1 PREDICTED: endoglucanase 3-like [Nicotiana sylves... 61 4e-09 XP_011095367.1 PREDICTED: endoglucanase 9-like [Sesamum indicum] 60 5e-09 CDP11514.1 unnamed protein product [Coffea canephora] 60 5e-09 XP_015056588.1 PREDICTED: endoglucanase 3-like [Solanum pennellii] 60 9e-09 NP_001234323.1 endo-1,4-beta-D-glucanase precursor [Solanum lyco... 60 9e-09 XP_010457267.1 PREDICTED: endoglucanase 1-like [Camelina sativa] 57 1e-08 XP_017215823.1 PREDICTED: endoglucanase 9-like [Daucus carota su... 59 1e-08 KZM86797.1 hypothetical protein DCAR_023931 [Daucus carota subsp... 59 1e-08 NP_001329141.1 glycosyl hydrolase 9B16 [Arabidopsis thaliana] Q9... 59 1e-08 GAU16385.1 hypothetical protein TSUD_117340 [Trifolium subterran... 59 1e-08 XP_020106762.1 LOW QUALITY PROTEIN: endoglucanase 11-like [Anana... 59 2e-08 OIW15370.1 hypothetical protein TanjilG_26743 [Lupinus angustifo... 59 2e-08 XP_006343479.1 PREDICTED: endoglucanase 3-like [Solanum tuberosum] 59 2e-08 XP_019437242.1 PREDICTED: endoglucanase 9-like [Lupinus angustif... 59 2e-08 >XP_019151835.1 PREDICTED: endoglucanase 3-like [Ipomoea nil] Length = 488 Score = 62.0 bits (149), Expect = 1e-09 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 98 VDYILGENPLKMSYMVGYGTNYPRRIHQR 12 VDYILGENP+KMSYMVGYGTNYPR+IH R Sbjct: 379 VDYILGENPMKMSYMVGYGTNYPRKIHHR 407 >XP_019155567.1 PREDICTED: endoglucanase 3-like isoform X2 [Ipomoea nil] Length = 422 Score = 61.2 bits (147), Expect = 3e-09 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 98 VDYILGENPLKMSYMVGYGTNYPRRIHQR 12 VDYILGENP+ MSYMVGYGTNYPRRIH R Sbjct: 314 VDYILGENPMSMSYMVGYGTNYPRRIHHR 342 >XP_019155566.1 PREDICTED: endoglucanase 3-like isoform X1 [Ipomoea nil] Length = 490 Score = 61.2 bits (147), Expect = 3e-09 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 98 VDYILGENPLKMSYMVGYGTNYPRRIHQR 12 VDYILGENP+ MSYMVGYGTNYPRRIH R Sbjct: 382 VDYILGENPMSMSYMVGYGTNYPRRIHHR 410 >XP_009603927.1 PREDICTED: endoglucanase 9-like [Nicotiana tomentosiformis] XP_016467406.1 PREDICTED: endoglucanase 9-like [Nicotiana tabacum] AAZ93631.1 endo-beta-1,4-glucanase [Nicotiana tabacum] Length = 489 Score = 60.8 bits (146), Expect = 4e-09 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 98 VDYILGENPLKMSYMVGYGTNYPRRIHQR 12 VDYILG NP+KMSYMVGYGTNYPRR+H R Sbjct: 381 VDYILGNNPMKMSYMVGYGTNYPRRVHHR 409 >AAL30452.1 endo-beta-1,4-glucanase precursor [Nicotiana tabacum] Length = 489 Score = 60.8 bits (146), Expect = 4e-09 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 98 VDYILGENPLKMSYMVGYGTNYPRRIHQR 12 VDYILG NP+KMSYMVGYGTNYPRR+H R Sbjct: 381 VDYILGNNPMKMSYMVGYGTNYPRRVHHR 409 >XP_019228899.1 PREDICTED: endoglucanase 9-like [Nicotiana attenuata] OIT30444.1 endoglucanase 3 [Nicotiana attenuata] Length = 492 Score = 60.8 bits (146), Expect = 4e-09 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 98 VDYILGENPLKMSYMVGYGTNYPRRIHQR 12 VDYILG NP+KMSYMVGYGTNYPRR+H R Sbjct: 384 VDYILGNNPMKMSYMVGYGTNYPRRVHHR 412 >XP_009788927.1 PREDICTED: endoglucanase 3-like [Nicotiana sylvestris] XP_016498594.1 PREDICTED: endoglucanase 3-like [Nicotiana tabacum] Length = 492 Score = 60.8 bits (146), Expect = 4e-09 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 98 VDYILGENPLKMSYMVGYGTNYPRRIHQR 12 VDYILG NP+KMSYMVGYGTNYPRR+H R Sbjct: 384 VDYILGNNPMKMSYMVGYGTNYPRRVHHR 412 >XP_011095367.1 PREDICTED: endoglucanase 9-like [Sesamum indicum] Length = 399 Score = 60.5 bits (145), Expect = 5e-09 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -1 Query: 98 VDYILGENPLKMSYMVGYGTNYPRRIHQR 12 VDYILG+NP+KMSYMVGYG+NYPRRIH R Sbjct: 292 VDYILGDNPMKMSYMVGYGSNYPRRIHHR 320 >CDP11514.1 unnamed protein product [Coffea canephora] Length = 492 Score = 60.5 bits (145), Expect = 5e-09 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 98 VDYILGENPLKMSYMVGYGTNYPRRIHQR 12 VDYILGENPLKMSYMVGYG++YPRRIH R Sbjct: 383 VDYILGENPLKMSYMVGYGSDYPRRIHHR 411 >XP_015056588.1 PREDICTED: endoglucanase 3-like [Solanum pennellii] Length = 479 Score = 59.7 bits (143), Expect = 9e-09 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 98 VDYILGENPLKMSYMVGYGTNYPRRIHQR 12 VDYILG NP+KMSYMVGYG+NYPRRIH R Sbjct: 371 VDYILGNNPMKMSYMVGYGSNYPRRIHHR 399 >NP_001234323.1 endo-1,4-beta-D-glucanase precursor [Solanum lycopersicum] CAA72133.1 endo-1,4-beta-D-glucanase [Solanum lycopersicum] Length = 479 Score = 59.7 bits (143), Expect = 9e-09 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 98 VDYILGENPLKMSYMVGYGTNYPRRIHQR 12 VDYILG NP+KMSYMVGYG+NYPRRIH R Sbjct: 371 VDYILGNNPMKMSYMVGYGSNYPRRIHHR 399 >XP_010457267.1 PREDICTED: endoglucanase 1-like [Camelina sativa] Length = 150 Score = 57.4 bits (137), Expect = 1e-08 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -1 Query: 98 VDYILGENPLKMSYMVGYGTNYPRRIHQR 12 VDY+LG+NPLKMSYMVGYG YPRRIH R Sbjct: 45 VDYLLGDNPLKMSYMVGYGPKYPRRIHHR 73 >XP_017215823.1 PREDICTED: endoglucanase 9-like [Daucus carota subsp. sativus] Length = 398 Score = 59.3 bits (142), Expect = 1e-08 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 98 VDYILGENPLKMSYMVGYGTNYPRRIHQR 12 VDYILG+NPLKMSYMVGYGT YP+RIH R Sbjct: 292 VDYILGDNPLKMSYMVGYGTKYPKRIHHR 320 >KZM86797.1 hypothetical protein DCAR_023931 [Daucus carota subsp. sativus] Length = 486 Score = 59.3 bits (142), Expect = 1e-08 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 98 VDYILGENPLKMSYMVGYGTNYPRRIHQR 12 VDYILG+NPLKMSYMVGYGT YP+RIH R Sbjct: 380 VDYILGDNPLKMSYMVGYGTKYPKRIHHR 408 >NP_001329141.1 glycosyl hydrolase 9B16 [Arabidopsis thaliana] Q9SVJ4.1 RecName: Full=Endoglucanase 22; AltName: Full=Endo-1,4-beta glucanase 22; AltName: Full=Glycosyl hydrolase 9B16; Flags: Precursor CAB38819.1 putative endo-1, 4-beta-glucanase [Arabidopsis thaliana] CAB80562.1 putative endo-1, 4-beta-glucanase [Arabidopsis thaliana] ANM67304.1 glycosyl hydrolase 9B16 [Arabidopsis thaliana] Length = 494 Score = 59.3 bits (142), Expect = 1e-08 Identities = 26/51 (50%), Positives = 36/51 (70%) Frame = -1 Query: 164 IFTLSRAFYILRMIHNPL*LS*VDYILGENPLKMSYMVGYGTNYPRRIHQR 12 I + + +Y+ + I N + VDYILG+NP+KMSYM+GYG YPR+IH R Sbjct: 365 ILSTTPLWYLTQRIANIVGFEKVDYILGDNPMKMSYMIGYGNRYPRQIHHR 415 >GAU16385.1 hypothetical protein TSUD_117340 [Trifolium subterraneum] Length = 293 Score = 58.9 bits (141), Expect = 1e-08 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 98 VDYILGENPLKMSYMVGYGTNYPRRIHQR 12 VDYILGENPLKMSYMVGYG N+P+RIH R Sbjct: 186 VDYILGENPLKMSYMVGYGPNFPKRIHHR 214 >XP_020106762.1 LOW QUALITY PROTEIN: endoglucanase 11-like [Ananas comosus] Length = 402 Score = 58.9 bits (141), Expect = 2e-08 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -1 Query: 98 VDYILGENPLKMSYMVGYGTNYPRRIHQR 12 VDYILGENPLKMSYMVGYGT++P+RIH R Sbjct: 292 VDYILGENPLKMSYMVGYGTHFPQRIHHR 320 >OIW15370.1 hypothetical protein TanjilG_26743 [Lupinus angustifolius] Length = 445 Score = 58.9 bits (141), Expect = 2e-08 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 98 VDYILGENPLKMSYMVGYGTNYPRRIHQR 12 VDYILGENPLKMSYMVGYG N+P+RIH R Sbjct: 338 VDYILGENPLKMSYMVGYGPNFPKRIHHR 366 >XP_006343479.1 PREDICTED: endoglucanase 3-like [Solanum tuberosum] Length = 482 Score = 58.9 bits (141), Expect = 2e-08 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -1 Query: 98 VDYILGENPLKMSYMVGYGTNYPRRIHQR 12 VDYILG NP+KMSYMVGYG NYPRRIH R Sbjct: 374 VDYILGNNPMKMSYMVGYGRNYPRRIHHR 402 >XP_019437242.1 PREDICTED: endoglucanase 9-like [Lupinus angustifolius] Length = 485 Score = 58.9 bits (141), Expect = 2e-08 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 98 VDYILGENPLKMSYMVGYGTNYPRRIHQR 12 VDYILGENPLKMSYMVGYG N+P+RIH R Sbjct: 378 VDYILGENPLKMSYMVGYGPNFPKRIHHR 406