BLASTX nr result
ID: Angelica27_contig00032758
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00032758 (276 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017227669.1 PREDICTED: pentatricopeptide repeat-containing pr... 78 7e-15 KZM80818.1 hypothetical protein DCAR_031614 [Daucus carota subsp... 78 7e-15 KVI01272.1 Pentatricopeptide repeat-containing protein [Cynara c... 61 8e-09 XP_012838136.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 7e-08 CDP09649.1 unnamed protein product [Coffea canephora] 57 1e-07 XP_009347168.1 PREDICTED: putative pentatricopeptide repeat-cont... 54 2e-06 XP_018833103.1 PREDICTED: putative pentatricopeptide repeat-cont... 54 3e-06 XP_018833102.1 PREDICTED: putative pentatricopeptide repeat-cont... 54 3e-06 >XP_017227669.1 PREDICTED: pentatricopeptide repeat-containing protein At4g14170-like isoform X1 [Daucus carota subsp. sativus] XP_017227670.1 PREDICTED: pentatricopeptide repeat-containing protein At4g14170-like isoform X2 [Daucus carota subsp. sativus] Length = 787 Score = 78.2 bits (191), Expect = 7e-15 Identities = 44/74 (59%), Positives = 52/74 (70%), Gaps = 4/74 (5%) Frame = +1 Query: 67 MLYHGPRCLRLAAKT----KPNLLRTIHFFHSHKEPHYIPSNILPTCSSTQSLAQTKQAH 234 MLYH R L L +K+ +PN + H H +PH++ SNILP CSST SLAQTKQAH Sbjct: 1 MLYHA-RSLFLPSKSLLKFRPNT-----YTHFHTQPHFVSSNILPICSSTLSLAQTKQAH 54 Query: 235 AVALLHGLLPHSVS 276 A+ALL GLLPHSVS Sbjct: 55 ALALLSGLLPHSVS 68 >KZM80818.1 hypothetical protein DCAR_031614 [Daucus carota subsp. sativus] Length = 880 Score = 78.2 bits (191), Expect = 7e-15 Identities = 44/74 (59%), Positives = 52/74 (70%), Gaps = 4/74 (5%) Frame = +1 Query: 67 MLYHGPRCLRLAAKT----KPNLLRTIHFFHSHKEPHYIPSNILPTCSSTQSLAQTKQAH 234 MLYH R L L +K+ +PN + H H +PH++ SNILP CSST SLAQTKQAH Sbjct: 1 MLYHA-RSLFLPSKSLLKFRPNT-----YTHFHTQPHFVSSNILPICSSTLSLAQTKQAH 54 Query: 235 AVALLHGLLPHSVS 276 A+ALL GLLPHSVS Sbjct: 55 ALALLSGLLPHSVS 68 >KVI01272.1 Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 797 Score = 60.8 bits (146), Expect = 8e-09 Identities = 33/61 (54%), Positives = 37/61 (60%) Frame = +1 Query: 94 RLAAKTKPNLLRTIHFFHSHKEPHYIPSNILPTCSSTQSLAQTKQAHAVALLHGLLPHSV 273 RL KP TI P NILP CSST+SLAQTKQ+HA+ALL G LPHS+ Sbjct: 22 RLETTPKPQFFSTI--------PQQSHHNILPLCSSTESLAQTKQSHAIALLSGYLPHSI 73 Query: 274 S 276 S Sbjct: 74 S 74 >XP_012838136.1 PREDICTED: pentatricopeptide repeat-containing protein At4g14170-like [Erythranthe guttata] Length = 820 Score = 58.2 bits (139), Expect = 7e-08 Identities = 34/73 (46%), Positives = 48/73 (65%), Gaps = 4/73 (5%) Frame = +1 Query: 70 LYHGPRCLRLAAKTKPNLLRTIHFFHSH---KEPHYIPS-NILPTCSSTQSLAQTKQAHA 237 ++H R LRLA+ T P L + FHS P + P+ +ILP C++ QSL+ T+QAHA Sbjct: 1 MFHHVRFLRLASPT-PTRLHPLAAFHSTGAPPPPQWPPTADILPICTAAQSLSSTRQAHA 59 Query: 238 VALLHGLLPHSVS 276 +A++HG LP SVS Sbjct: 60 LAVIHGHLPSSVS 72 >CDP09649.1 unnamed protein product [Coffea canephora] Length = 791 Score = 57.4 bits (137), Expect = 1e-07 Identities = 31/65 (47%), Positives = 39/65 (60%), Gaps = 14/65 (21%) Frame = +1 Query: 124 LRTIHFFHSHKEPHYI--------------PSNILPTCSSTQSLAQTKQAHAVALLHGLL 261 LR + FHSH P ++ P N+LP C+STQSL QTKQAHA+ + HGLL Sbjct: 14 LRLLKHFHSH--PPFLSPTSAKCRPPLSQPPPNLLPLCASTQSLNQTKQAHAICIHHGLL 71 Query: 262 PHSVS 276 P S+S Sbjct: 72 PSSIS 76 >XP_009347168.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g69350, mitochondrial [Pyrus x bretschneideri] Length = 896 Score = 53.9 bits (128), Expect = 2e-06 Identities = 29/60 (48%), Positives = 37/60 (61%), Gaps = 5/60 (8%) Frame = +1 Query: 112 KPNLLRTIHFFHS-----HKEPHYIPSNILPTCSSTQSLAQTKQAHAVALLHGLLPHSVS 276 KPN RT++ + H P Y S++L S Q+L QTKQ HA ALL+G+LPHSVS Sbjct: 80 KPNTTRTLYLSTTTTPCTHASPTYPRSDLLTLSSDVQTLCQTKQVHASALLNGVLPHSVS 139 >XP_018833103.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g69350, mitochondrial isoform X2 [Juglans regia] Length = 787 Score = 53.5 bits (127), Expect = 3e-06 Identities = 34/73 (46%), Positives = 45/73 (61%), Gaps = 4/73 (5%) Frame = +1 Query: 70 LYHGPRCLRLAA----KTKPNLLRTIHFFHSHKEPHYIPSNILPTCSSTQSLAQTKQAHA 237 L+H + L L + K+K N + + FF + + SN+L CS+ QSL QTKQAHA Sbjct: 3 LHHARKTLLLVSACSCKSKQNHAQIL-FFCTTTSCTHSNSNLLTICSNAQSLRQTKQAHA 61 Query: 238 VALLHGLLPHSVS 276 ALL+GLLP SVS Sbjct: 62 SALLNGLLPRSVS 74 >XP_018833102.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g69350, mitochondrial isoform X1 [Juglans regia] Length = 814 Score = 53.5 bits (127), Expect = 3e-06 Identities = 34/73 (46%), Positives = 45/73 (61%), Gaps = 4/73 (5%) Frame = +1 Query: 70 LYHGPRCLRLAA----KTKPNLLRTIHFFHSHKEPHYIPSNILPTCSSTQSLAQTKQAHA 237 L+H + L L + K+K N + + FF + + SN+L CS+ QSL QTKQAHA Sbjct: 3 LHHARKTLLLVSACSCKSKQNHAQIL-FFCTTTSCTHSNSNLLTICSNAQSLRQTKQAHA 61 Query: 238 VALLHGLLPHSVS 276 ALL+GLLP SVS Sbjct: 62 SALLNGLLPRSVS 74