BLASTX nr result
ID: Angelica27_contig00032756
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00032756 (298 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017215909.1 PREDICTED: LON peptidase N-terminal domain and RI... 62 4e-09 >XP_017215909.1 PREDICTED: LON peptidase N-terminal domain and RING finger protein 1 [Daucus carota subsp. sativus] KZM88961.1 hypothetical protein DCAR_026036 [Daucus carota subsp. sativus] Length = 482 Score = 62.0 bits (149), Expect = 4e-09 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 3 ERLNVLRMRDTNERFRYAVFFMQAEEEGWRVR 98 ERLN+LR+RDTNER +YAVFFMQAEE+GWRVR Sbjct: 451 ERLNLLRLRDTNERLQYAVFFMQAEEQGWRVR 482