BLASTX nr result
ID: Angelica27_contig00032358
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00032358 (406 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011098593.1 PREDICTED: ribonuclease S-2-like isoform X1 [Sesa... 42 3e-07 XP_012572983.1 PREDICTED: ribonuclease DdI-like [Cicer arietinum] 45 2e-06 XP_011098594.1 PREDICTED: ribonuclease S-2-like isoform X2 [Sesa... 42 7e-06 KYP34632.1 Ribonuclease 3 [Cajanus cajan] 45 7e-06 >XP_011098593.1 PREDICTED: ribonuclease S-2-like isoform X1 [Sesamum indicum] Length = 230 Score = 42.4 bits (98), Expect(2) = 3e-07 Identities = 24/54 (44%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = +1 Query: 37 YLVSVTLLLCC-SEAQIAELNHLQLVNAWSRTFC--QYTQCKQSVTENFYLHGL 189 + V + LLLC A NHL LV W TFC + CK+ V +NF LHGL Sbjct: 9 FYVLLFLLLCSYGSASSNSYNHLLLVYTWPNTFCLDRSVTCKKPVPQNFALHGL 62 Score = 39.3 bits (90), Expect(2) = 3e-07 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +3 Query: 261 KDNQVTAAIKNNKAQLETYWPSIIEGSTGESFWKNEWTQHGPC 389 K ++ A++ + QLE W S+ T FW+ +W +HG C Sbjct: 77 KTGSISQALQKYERQLEICWSSLRRDFTNREFWQYQWNKHGTC 119 >XP_012572983.1 PREDICTED: ribonuclease DdI-like [Cicer arietinum] Length = 257 Score = 45.4 bits (106), Expect(2) = 2e-06 Identities = 21/47 (44%), Positives = 27/47 (57%) Frame = +3 Query: 264 DNQVTAAIKNNKAQLETYWPSIIEGSTGESFWKNEWTQHGPCTDLKP 404 D + A +KN QL WPS+I+GS FW +WT HG C+ L P Sbjct: 120 DWNIMAGLKN---QLNKDWPSLIKGSHNIVFWNEQWTVHGTCSLLDP 163 Score = 33.1 bits (74), Expect(2) = 2e-06 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 Query: 82 IAELNHLQLVNAWSRTFCQYTQCKQSVTENFYLHGL 189 + +H L W TFC+ +C + NF +HGL Sbjct: 66 VPTFDHFVLAETWPATFCKIKRCVNPMPINFTIHGL 101 >XP_011098594.1 PREDICTED: ribonuclease S-2-like isoform X2 [Sesamum indicum] Length = 228 Score = 42.4 bits (98), Expect(2) = 7e-06 Identities = 24/54 (44%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = +1 Query: 37 YLVSVTLLLCC-SEAQIAELNHLQLVNAWSRTFC--QYTQCKQSVTENFYLHGL 189 + V + LLLC A NHL LV W TFC + CK+ V +NF LHGL Sbjct: 9 FYVLLFLLLCSYGSASSNSYNHLLLVYTWPNTFCLDRSVTCKKPVPQNFALHGL 62 Score = 34.7 bits (78), Expect(2) = 7e-06 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +3 Query: 303 QLETYWPSIIEGSTGESFWKNEWTQHGPC 389 QLE W S+ T FW+ +W +HG C Sbjct: 89 QLEICWSSLRRDFTNREFWQYQWNKHGTC 117 >KYP34632.1 Ribonuclease 3 [Cajanus cajan] Length = 208 Score = 45.4 bits (106), Expect(2) = 7e-06 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 1/52 (1%) Frame = +3 Query: 246 CP-DKYKDNQVTAAIKNNKAQLETYWPSIIEGSTGESFWKNEWTQHGPCTDL 398 CP +K+ N++ +N K+QLET WP++ +G SFW EW +HG C+ L Sbjct: 65 CPSNKFDSNKIK---QNLKSQLETNWPALKDGRN-VSFWTYEWDKHGSCSQL 112 Score = 31.6 bits (70), Expect(2) = 7e-06 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +1 Query: 103 QLVNAWSRTFCQYTQCKQSVTENFYLHGL 189 +L W TFC+ T C ++ F +HGL Sbjct: 24 KLAETWPPTFCRSTPCAVQISSKFTIHGL 52