BLASTX nr result
ID: Angelica27_contig00032352
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00032352 (329 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017222880.1 PREDICTED: elongator complex protein 1 [Daucus ca... 56 1e-11 >XP_017222880.1 PREDICTED: elongator complex protein 1 [Daucus carota subsp. sativus] XP_017222881.1 PREDICTED: elongator complex protein 1 [Daucus carota subsp. sativus] KZM84912.1 hypothetical protein DCAR_027666 [Daucus carota subsp. sativus] Length = 1305 Score = 55.8 bits (133), Expect(2) = 1e-11 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 328 LNKEDIARKLQRVGENFQLSQMEAVNLAADA 236 LNKEDIARKLQRVGENFQL QM AV+LAADA Sbjct: 1235 LNKEDIARKLQRVGENFQLCQMAAVSLAADA 1265 Score = 40.8 bits (94), Expect(2) = 1e-11 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = -3 Query: 189 YNR*KRKELLHSEAFSWQIKIFLS 118 Y + RKELLHSEAFSWQ+K+FLS Sbjct: 1281 YMKKVRKELLHSEAFSWQVKMFLS 1304