BLASTX nr result
ID: Angelica27_contig00032350
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00032350 (248 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008045700.1 hypothetical protein TRAVEDRAFT_41087 [Trametes v... 61 6e-11 XP_007371719.1 hypothetical protein DICSQDRAFT_73579, partial [D... 50 3e-06 EMD31869.1 hypothetical protein CERSUDRAFT_162701, partial [Gela... 50 3e-06 >XP_008045700.1 hypothetical protein TRAVEDRAFT_41087 [Trametes versicolor FP-101664 SS1] EIW51413.1 hypothetical protein TRAVEDRAFT_41087 [Trametes versicolor FP-101664 SS1] Length = 51 Score = 61.2 bits (147), Expect = 6e-11 Identities = 26/46 (56%), Positives = 31/46 (67%) Frame = +2 Query: 47 SKPSQKARCVPQSPRMYPVESYNTAEAATFKPPLSTPEN*CWPANR 184 + PS KARCVP+S +Y E YNT E ATF P S+ +N CWP NR Sbjct: 3 ANPSHKARCVPRSQPLYATEGYNTPEGATFLQPFSSGQNRCWPVNR 48 >XP_007371719.1 hypothetical protein DICSQDRAFT_73579, partial [Dichomitus squalens LYAD-421 SS1] EJF55541.1 hypothetical protein DICSQDRAFT_73579, partial [Dichomitus squalens LYAD-421 SS1] Length = 59 Score = 49.7 bits (117), Expect = 3e-06 Identities = 25/50 (50%), Positives = 28/50 (56%) Frame = +2 Query: 53 PSQKARCVPQSPRMYPVESYNTAEAATFKPPLSTPEN*CWPANRSKLRQA 202 P ARCVP+S Y YNT E AT P S +N CWP NR K+ QA Sbjct: 1 PCLAARCVPRSQPPYATRVYNTPEGATLLQPFSDGQNRCWPVNR-KVHQA 49 >EMD31869.1 hypothetical protein CERSUDRAFT_162701, partial [Gelatoporia subvermispora B] Length = 87 Score = 49.7 bits (117), Expect(2) = 3e-06 Identities = 25/50 (50%), Positives = 29/50 (58%) Frame = +2 Query: 53 PSQKARCVPQSPRMYPVESYNTAEAATFKPPLSTPEN*CWPANRSKLRQA 202 P+ KA C P+S Y E YNT E ATF P S N CWP +R K+ QA Sbjct: 29 PTIKACCEPRSQPSYATEGYNTPEGATFPLPFSDDRNRCWPVDR-KVHQA 77 Score = 28.5 bits (62), Expect(2) = 3e-06 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 1 TGRLKSLHQHPKREKVET 54 TGRLK L QHPK E+ T Sbjct: 11 TGRLKPLRQHPKHERGRT 28