BLASTX nr result
ID: Angelica27_contig00029966
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00029966 (298 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017243273.1 PREDICTED: pentatricopeptide repeat-containing pr... 164 1e-45 OAY31609.1 hypothetical protein MANES_14G126400 [Manihot esculenta] 118 7e-29 GAV85267.1 PPR domain-containing protein/PPR_2 domain-containing... 114 1e-27 XP_010662700.1 PREDICTED: pentatricopeptide repeat-containing pr... 114 1e-27 KJB08223.1 hypothetical protein B456_001G071600 [Gossypium raimo... 113 3e-27 XP_010053549.1 PREDICTED: pentatricopeptide repeat-containing pr... 113 4e-27 XP_002533788.1 PREDICTED: pentatricopeptide repeat-containing pr... 113 4e-27 XP_016744360.1 PREDICTED: pentatricopeptide repeat-containing pr... 113 4e-27 XP_012469457.1 PREDICTED: pentatricopeptide repeat-containing pr... 113 4e-27 KHG29599.1 hypothetical protein F383_15054 [Gossypium arboreum] 112 1e-26 XP_017643972.1 PREDICTED: pentatricopeptide repeat-containing pr... 112 1e-26 XP_016712980.1 PREDICTED: pentatricopeptide repeat-containing pr... 112 1e-26 EOX92962.1 Pentatricopeptide repeat superfamily protein, putativ... 112 1e-26 XP_007048805.2 PREDICTED: pentatricopeptide repeat-containing pr... 111 2e-26 XP_006480451.1 PREDICTED: pentatricopeptide repeat-containing pr... 110 5e-26 XP_006385578.1 hypothetical protein POPTR_0003s08270g [Populus t... 110 5e-26 XP_006480449.1 PREDICTED: pentatricopeptide repeat-containing pr... 110 5e-26 XP_006428630.1 hypothetical protein CICLE_v10011185mg [Citrus cl... 110 5e-26 XP_011031992.1 PREDICTED: pentatricopeptide repeat-containing pr... 108 2e-25 XP_008240720.1 PREDICTED: pentatricopeptide repeat-containing pr... 108 2e-25 >XP_017243273.1 PREDICTED: pentatricopeptide repeat-containing protein At4g17616 [Daucus carota subsp. sativus] XP_017243274.1 PREDICTED: pentatricopeptide repeat-containing protein At4g17616 [Daucus carota subsp. sativus] KZN01500.1 hypothetical protein DCAR_010235 [Daucus carota subsp. sativus] Length = 701 Score = 164 bits (416), Expect = 1e-45 Identities = 81/98 (82%), Positives = 91/98 (92%) Frame = +3 Query: 3 SLSLARAQMPVDASMIVRVMLERERLPEVNTLGLVILHMVNTNIGMYLASNILFEICECT 182 SLSLARAQMPVDAS I+R+MLE+E LPE+N LGL+ LH+VNT IGM+LASNILFEICECT Sbjct: 152 SLSLARAQMPVDASKILRLMLEKEWLPEMNMLGLIFLHLVNTEIGMFLASNILFEICECT 211 Query: 183 KVSLGENQIKLDTVTFNLVLDACVRFGSFLKGQQIIEL 296 K S GENQIK+DTVTFNLVLDACVRFGS+LKGQQII+L Sbjct: 212 KTSSGENQIKVDTVTFNLVLDACVRFGSYLKGQQIIDL 249 >OAY31609.1 hypothetical protein MANES_14G126400 [Manihot esculenta] Length = 748 Score = 118 bits (295), Expect = 7e-29 Identities = 63/102 (61%), Positives = 75/102 (73%), Gaps = 5/102 (4%) Frame = +3 Query: 3 SLSLARAQMPVDASMIVRVMLERERLPEVNTLGLVILHMVNTNIGMYLASNILFEICE-- 176 ++SLARAQMP+ ASMI+RVMLERE +P V+ L L+ LHMV T IG YLASN L +IC+ Sbjct: 200 AISLARAQMPIPASMILRVMLERENIPPVSVLQLIFLHMVKTEIGAYLASNFLIQICDYF 259 Query: 177 ---CTKVSLGENQIKLDTVTFNLVLDACVRFGSFLKGQQIIE 293 K S IK DT+TFNLVLDACVRF S LKGQ+I+E Sbjct: 260 LHLSAKRSEHRKMIKPDTMTFNLVLDACVRFKSSLKGQEILE 301 >GAV85267.1 PPR domain-containing protein/PPR_2 domain-containing protein/PPR_3 domain-containing protein [Cephalotus follicularis] Length = 696 Score = 114 bits (286), Expect = 1e-27 Identities = 61/103 (59%), Positives = 74/103 (71%), Gaps = 5/103 (4%) Frame = +3 Query: 3 SLSLARAQMPVDASMIVRVMLERERLPEVNTLGLVILHMVNTNIGMYLASNILFEICECT 182 SL LARAQMPV ASMI+R MLE+ LP ++ L LV LHMV + IG Y+ASN L EIC+C Sbjct: 141 SLCLARAQMPVPASMILRFMLEKGNLPGMDILSLVYLHMVKSEIGTYIASNFLVEICDCF 200 Query: 183 KVSLGENQI-----KLDTVTFNLVLDACVRFGSFLKGQQIIEL 296 ++ I K DT+ FNLVLDACVRFGS LKGQQ++E+ Sbjct: 201 RLLRANKNIRAKLTKPDTLIFNLVLDACVRFGSSLKGQQLMEM 243 >XP_010662700.1 PREDICTED: pentatricopeptide repeat-containing protein At4g17616 [Vitis vinifera] Length = 716 Score = 114 bits (286), Expect = 1e-27 Identities = 63/103 (61%), Positives = 74/103 (71%), Gaps = 5/103 (4%) Frame = +3 Query: 3 SLSLARAQMPVDASMIVRVMLERERLPEVNTLGLVILHMVNTNIGMYLASNILFEICE-- 176 SLSL+RAQMP+ ASMI+R+MLE+ +P+ N L L+ILHMV T IG YLASN L +IC+ Sbjct: 162 SLSLSRAQMPIPASMILRLMLEKGSVPQKNVLWLIILHMVKTEIGTYLASNYLVQICDHF 221 Query: 177 ---CTKVSLGENQIKLDTVTFNLVLDACVRFGSFLKGQQIIEL 296 S IK DT+ FNLVLDACVRFGS KGQQIIEL Sbjct: 222 LLLSASKSNHAKLIKPDTMIFNLVLDACVRFGSSFKGQQIIEL 264 >KJB08223.1 hypothetical protein B456_001G071600 [Gossypium raimondii] Length = 575 Score = 113 bits (282), Expect = 3e-27 Identities = 60/103 (58%), Positives = 76/103 (73%), Gaps = 5/103 (4%) Frame = +3 Query: 3 SLSLARAQMPVDASMIVRVMLERERLPEVNTLGLVILHMVNTNIGMYLASNILFEICE-- 176 +LSL+RAQMP+ +S I+R+MLE+ LP +N L L+ LHMV T +G +ASN+L +IC+ Sbjct: 20 ALSLSRAQMPIPSSTILRLMLEKGMLPPINVLQLLFLHMVKTEVGACIASNLLIQICDNY 79 Query: 177 ---CTKVSLGENQIKLDTVTFNLVLDACVRFGSFLKGQQIIEL 296 C+ S N +K DTV FNLVLDACVRFGS LKGQQIIEL Sbjct: 80 VQFCSGKSPCANLLKPDTVIFNLVLDACVRFGSPLKGQQIIEL 122 >XP_010053549.1 PREDICTED: pentatricopeptide repeat-containing protein At4g17616 [Eucalyptus grandis] Length = 688 Score = 113 bits (282), Expect = 4e-27 Identities = 59/102 (57%), Positives = 78/102 (76%), Gaps = 5/102 (4%) Frame = +3 Query: 3 SLSLARAQMPVDASMIVRVMLERERLPEVNTLGLVILHMVNTNIGMYLASNILFEICEC- 179 +LS+ARA+MPV ASMI+R++L+++ LP + L LV+LHMV T IG YLASN+LF++ +C Sbjct: 137 ALSVARAKMPVPASMILRLLLQKKYLPPFDILNLVLLHMVKTEIGTYLASNLLFQMSDCY 196 Query: 180 ----TKVSLGENQIKLDTVTFNLVLDACVRFGSFLKGQQIIE 293 + S N++K DT+ FNLVLDACVRFGS LKGQ IIE Sbjct: 197 QHITIRGSNLRNKMKSDTIIFNLVLDACVRFGSALKGQDIIE 238 >XP_002533788.1 PREDICTED: pentatricopeptide repeat-containing protein At4g17616 [Ricinus communis] XP_015583603.1 PREDICTED: pentatricopeptide repeat-containing protein At4g17616 [Ricinus communis] EEF28601.1 pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 689 Score = 113 bits (282), Expect = 4e-27 Identities = 58/102 (56%), Positives = 74/102 (72%), Gaps = 5/102 (4%) Frame = +3 Query: 3 SLSLARAQMPVDASMIVRVMLERERLPEVNTLGLVILHMVNTNIGMYLASNILFEICEC- 179 SLS ARAQMP+ ASM++RV+LERE P V+ L L++ HMV T +G LASN L +ICEC Sbjct: 142 SLSFARAQMPIPASMVLRVILERENTPAVSLLRLIVFHMVKTEVGTCLASNFLIQICECL 201 Query: 180 TKVSLGENQ----IKLDTVTFNLVLDACVRFGSFLKGQQIIE 293 ++S N IKLDT+ FNLVL+ CVRF S LKGQ+++E Sbjct: 202 LRISANRNDHAKVIKLDTLIFNLVLEGCVRFKSSLKGQELVE 243 >XP_016744360.1 PREDICTED: pentatricopeptide repeat-containing protein At4g17616-like [Gossypium hirsutum] XP_016744361.1 PREDICTED: pentatricopeptide repeat-containing protein At4g17616-like [Gossypium hirsutum] Length = 708 Score = 113 bits (282), Expect = 4e-27 Identities = 60/103 (58%), Positives = 76/103 (73%), Gaps = 5/103 (4%) Frame = +3 Query: 3 SLSLARAQMPVDASMIVRVMLERERLPEVNTLGLVILHMVNTNIGMYLASNILFEICE-- 176 +LSL+RAQMP+ +S I+R+MLE+ LP +N L L+ LHMV T +G +ASN+L +IC+ Sbjct: 153 ALSLSRAQMPIPSSTILRLMLEKGMLPPMNVLQLLFLHMVKTEVGACIASNLLIQICDNY 212 Query: 177 ---CTKVSLGENQIKLDTVTFNLVLDACVRFGSFLKGQQIIEL 296 C+ S N +K DTV FNLVLDACVRFGS LKGQQIIEL Sbjct: 213 VQFCSGKSPCANLLKPDTVIFNLVLDACVRFGSSLKGQQIIEL 255 >XP_012469457.1 PREDICTED: pentatricopeptide repeat-containing protein At4g17616 [Gossypium raimondii] XP_012469466.1 PREDICTED: pentatricopeptide repeat-containing protein At4g17616 [Gossypium raimondii] XP_012469475.1 PREDICTED: pentatricopeptide repeat-containing protein At4g17616 [Gossypium raimondii] XP_012469482.1 PREDICTED: pentatricopeptide repeat-containing protein At4g17616 [Gossypium raimondii] KJB08221.1 hypothetical protein B456_001G071600 [Gossypium raimondii] KJB08222.1 hypothetical protein B456_001G071600 [Gossypium raimondii] Length = 708 Score = 113 bits (282), Expect = 4e-27 Identities = 60/103 (58%), Positives = 76/103 (73%), Gaps = 5/103 (4%) Frame = +3 Query: 3 SLSLARAQMPVDASMIVRVMLERERLPEVNTLGLVILHMVNTNIGMYLASNILFEICE-- 176 +LSL+RAQMP+ +S I+R+MLE+ LP +N L L+ LHMV T +G +ASN+L +IC+ Sbjct: 153 ALSLSRAQMPIPSSTILRLMLEKGMLPPINVLQLLFLHMVKTEVGACIASNLLIQICDNY 212 Query: 177 ---CTKVSLGENQIKLDTVTFNLVLDACVRFGSFLKGQQIIEL 296 C+ S N +K DTV FNLVLDACVRFGS LKGQQIIEL Sbjct: 213 VQFCSGKSPCANLLKPDTVIFNLVLDACVRFGSPLKGQQIIEL 255 >KHG29599.1 hypothetical protein F383_15054 [Gossypium arboreum] Length = 690 Score = 112 bits (279), Expect = 1e-26 Identities = 60/103 (58%), Positives = 75/103 (72%), Gaps = 5/103 (4%) Frame = +3 Query: 3 SLSLARAQMPVDASMIVRVMLERERLPEVNTLGLVILHMVNTNIGMYLASNILFEICE-- 176 +LSL+RAQMP+ +S I+R+MLE+ LP +N L L LHMV T +G +ASN+L +IC+ Sbjct: 153 ALSLSRAQMPIPSSTILRLMLEKGMLPPMNVLQLSFLHMVKTEVGACIASNLLIQICDNY 212 Query: 177 ---CTKVSLGENQIKLDTVTFNLVLDACVRFGSFLKGQQIIEL 296 C+ S N +K DTV FNLVLDACVRFGS LKGQQIIEL Sbjct: 213 VRFCSGKSPCANLLKPDTVIFNLVLDACVRFGSSLKGQQIIEL 255 >XP_017643972.1 PREDICTED: pentatricopeptide repeat-containing protein At4g17616 [Gossypium arboreum] XP_017643973.1 PREDICTED: pentatricopeptide repeat-containing protein At4g17616 [Gossypium arboreum] Length = 708 Score = 112 bits (279), Expect = 1e-26 Identities = 60/103 (58%), Positives = 75/103 (72%), Gaps = 5/103 (4%) Frame = +3 Query: 3 SLSLARAQMPVDASMIVRVMLERERLPEVNTLGLVILHMVNTNIGMYLASNILFEICE-- 176 +LSL+RAQMP+ +S I+R+MLE+ LP +N L L LHMV T +G +ASN+L +IC+ Sbjct: 153 ALSLSRAQMPIPSSTILRLMLEKGMLPPMNVLQLSFLHMVKTEVGACIASNLLIQICDNY 212 Query: 177 ---CTKVSLGENQIKLDTVTFNLVLDACVRFGSFLKGQQIIEL 296 C+ S N +K DTV FNLVLDACVRFGS LKGQQIIEL Sbjct: 213 VRFCSGKSPCANLLKPDTVIFNLVLDACVRFGSSLKGQQIIEL 255 >XP_016712980.1 PREDICTED: pentatricopeptide repeat-containing protein At4g17616-like [Gossypium hirsutum] XP_016712981.1 PREDICTED: pentatricopeptide repeat-containing protein At4g17616-like [Gossypium hirsutum] Length = 708 Score = 112 bits (279), Expect = 1e-26 Identities = 60/103 (58%), Positives = 75/103 (72%), Gaps = 5/103 (4%) Frame = +3 Query: 3 SLSLARAQMPVDASMIVRVMLERERLPEVNTLGLVILHMVNTNIGMYLASNILFEICE-- 176 +LSL+RAQMP+ +S I+R+MLE+ LP +N L L LHMV T +G +ASN+L +IC+ Sbjct: 153 ALSLSRAQMPIPSSTILRLMLEKGMLPPMNVLQLSFLHMVKTEVGACIASNLLIQICDNY 212 Query: 177 ---CTKVSLGENQIKLDTVTFNLVLDACVRFGSFLKGQQIIEL 296 C+ S N +K DTV FNLVLDACVRFGS LKGQQIIEL Sbjct: 213 VRFCSGKSPCANLLKPDTVIFNLVLDACVRFGSSLKGQQIIEL 255 >EOX92962.1 Pentatricopeptide repeat superfamily protein, putative isoform 1 [Theobroma cacao] EOX92963.1 Pentatricopeptide repeat superfamily protein, putative isoform 1 [Theobroma cacao] Length = 708 Score = 112 bits (279), Expect = 1e-26 Identities = 60/102 (58%), Positives = 75/102 (73%), Gaps = 5/102 (4%) Frame = +3 Query: 6 LSLARAQMPVDASMIVRVMLERERLPEVNTLGLVILHMVNTNIGMYLASNILFEICE--- 176 LSLARAQMP+ +S I+R+MLE+E LP +N L LV HMV T +G +ASN+L +IC+ Sbjct: 154 LSLARAQMPIPSSTILRLMLEKEILPPINVLWLVFQHMVKTEVGTCVASNLLVQICDYYI 213 Query: 177 --CTKVSLGENQIKLDTVTFNLVLDACVRFGSFLKGQQIIEL 296 C++ S N +K DT+ FNLVLDACVRF S LKGQQIIEL Sbjct: 214 RFCSEKSHYANFLKPDTMIFNLVLDACVRFASSLKGQQIIEL 255 >XP_007048805.2 PREDICTED: pentatricopeptide repeat-containing protein At4g17616 [Theobroma cacao] XP_007048806.2 PREDICTED: pentatricopeptide repeat-containing protein At4g17616 [Theobroma cacao] Length = 708 Score = 111 bits (277), Expect = 2e-26 Identities = 60/102 (58%), Positives = 75/102 (73%), Gaps = 5/102 (4%) Frame = +3 Query: 6 LSLARAQMPVDASMIVRVMLERERLPEVNTLGLVILHMVNTNIGMYLASNILFEICE--- 176 LSLARAQMP+ +S I+R+MLE+E LP +N L LV HMV T +G +ASN+L +IC+ Sbjct: 154 LSLARAQMPIPSSTILRLMLEKEILPPMNVLWLVFQHMVKTEVGTCVASNLLVQICDYYI 213 Query: 177 --CTKVSLGENQIKLDTVTFNLVLDACVRFGSFLKGQQIIEL 296 C++ S N +K DT+ FNLVLDACVRF S LKGQQIIEL Sbjct: 214 RFCSEKSHYANFLKPDTMIFNLVLDACVRFASSLKGQQIIEL 255 >XP_006480451.1 PREDICTED: pentatricopeptide repeat-containing protein At4g17616-like isoform X2 [Citrus sinensis] Length = 646 Score = 110 bits (274), Expect = 5e-26 Identities = 62/103 (60%), Positives = 72/103 (69%), Gaps = 5/103 (4%) Frame = +3 Query: 3 SLSLARAQMPVDASMIVRVMLERERLPEVNTLGLVILHMVNTNIGMYLASNILFEICE-- 176 SLSLARAQMPV ASMI+R+ML RE LP + L LV +HMV T IG LASN L ++C+ Sbjct: 159 SLSLARAQMPVPASMILRLMLGRENLPRSDLLSLVFVHMVKTEIGTCLASNFLIQLCDVF 218 Query: 177 ---CTKVSLGENQIKLDTVTFNLVLDACVRFGSFLKGQQIIEL 296 + S G IK DT+ FNLVL ACVRFGS LKGQ I+EL Sbjct: 219 LHLSAEKSNGAELIKPDTMIFNLVLHACVRFGSSLKGQHIMEL 261 >XP_006385578.1 hypothetical protein POPTR_0003s08270g [Populus trichocarpa] ERP63375.1 hypothetical protein POPTR_0003s08270g [Populus trichocarpa] Length = 701 Score = 110 bits (274), Expect = 5e-26 Identities = 59/103 (57%), Positives = 73/103 (70%), Gaps = 5/103 (4%) Frame = +3 Query: 3 SLSLARAQMPVDASMIVRVMLERERLPEVNTLGLVILHMVNTNIGMYLASNILFEICEC- 179 S+SLARAQMPV ASMI+RVMLERE +P + L V+ HMV T IG LASN L ++C+C Sbjct: 152 SISLARAQMPVPASMILRVMLERENMPPLTILWSVVSHMVKTEIGACLASNFLVQMCDCF 211 Query: 180 ----TKVSLGENQIKLDTVTFNLVLDACVRFGSFLKGQQIIEL 296 K S+ +K D + FNLVLDACV+F S LKGQ+I+EL Sbjct: 212 LHLSAKGSVRAKVVKPDAMIFNLVLDACVKFKSSLKGQEIVEL 254 >XP_006480449.1 PREDICTED: pentatricopeptide repeat-containing protein At4g17616-like isoform X1 [Citrus sinensis] XP_006480450.1 PREDICTED: pentatricopeptide repeat-containing protein At4g17616-like isoform X1 [Citrus sinensis] Length = 712 Score = 110 bits (274), Expect = 5e-26 Identities = 62/103 (60%), Positives = 72/103 (69%), Gaps = 5/103 (4%) Frame = +3 Query: 3 SLSLARAQMPVDASMIVRVMLERERLPEVNTLGLVILHMVNTNIGMYLASNILFEICE-- 176 SLSLARAQMPV ASMI+R+ML RE LP + L LV +HMV T IG LASN L ++C+ Sbjct: 159 SLSLARAQMPVPASMILRLMLGRENLPRSDLLSLVFVHMVKTEIGTCLASNFLIQLCDVF 218 Query: 177 ---CTKVSLGENQIKLDTVTFNLVLDACVRFGSFLKGQQIIEL 296 + S G IK DT+ FNLVL ACVRFGS LKGQ I+EL Sbjct: 219 LHLSAEKSNGAELIKPDTMIFNLVLHACVRFGSSLKGQHIMEL 261 >XP_006428630.1 hypothetical protein CICLE_v10011185mg [Citrus clementina] ESR41870.1 hypothetical protein CICLE_v10011185mg [Citrus clementina] Length = 712 Score = 110 bits (274), Expect = 5e-26 Identities = 62/103 (60%), Positives = 72/103 (69%), Gaps = 5/103 (4%) Frame = +3 Query: 3 SLSLARAQMPVDASMIVRVMLERERLPEVNTLGLVILHMVNTNIGMYLASNILFEICE-- 176 SLSLARAQMPV ASMI+R+ML RE LP + L LV +HMV T IG LASN L ++C+ Sbjct: 159 SLSLARAQMPVPASMILRLMLGRENLPRSDLLSLVFVHMVKTEIGTCLASNFLIQLCDVF 218 Query: 177 ---CTKVSLGENQIKLDTVTFNLVLDACVRFGSFLKGQQIIEL 296 + S G IK DT+ FNLVL ACVRFGS LKGQ I+EL Sbjct: 219 LHLSAEKSNGAELIKPDTMIFNLVLHACVRFGSSLKGQHIMEL 261 >XP_011031992.1 PREDICTED: pentatricopeptide repeat-containing protein At4g17616-like [Populus euphratica] Length = 701 Score = 108 bits (270), Expect = 2e-25 Identities = 58/103 (56%), Positives = 72/103 (69%), Gaps = 5/103 (4%) Frame = +3 Query: 3 SLSLARAQMPVDASMIVRVMLERERLPEVNTLGLVILHMVNTNIGMYLASNILFEICEC- 179 S+SLARAQMP ASMI+RVMLERE +P + L V+ HMV T IG LASN L ++C+C Sbjct: 152 SISLARAQMPAPASMILRVMLERENMPPLTILWSVVSHMVKTEIGACLASNFLVQMCDCF 211 Query: 180 ----TKVSLGENQIKLDTVTFNLVLDACVRFGSFLKGQQIIEL 296 K S+ +K D + FNLVLDACV+F S LKGQ+I+EL Sbjct: 212 LHLSAKGSVRAKVVKPDAMIFNLVLDACVKFKSSLKGQEIVEL 254 >XP_008240720.1 PREDICTED: pentatricopeptide repeat-containing protein At4g17616 [Prunus mume] Length = 718 Score = 108 bits (269), Expect = 2e-25 Identities = 56/103 (54%), Positives = 73/103 (70%), Gaps = 5/103 (4%) Frame = +3 Query: 3 SLSLARAQMPVDASMIVRVMLERERLPEVNTLGLVILHMVNTNIGMYLASNILFEICEC- 179 SLSLAR++MP A+MI+R++LE+E LP +N L LV+LHMV T +G +LASN L +IC C Sbjct: 166 SLSLARSEMPKPATMILRILLEKENLPPMNVLCLVVLHMVKTEVGTHLASNFLVQICHCF 225 Query: 180 ----TKVSLGENQIKLDTVTFNLVLDACVRFGSFLKGQQIIEL 296 S+ +K +T+ FNLVLDACVRF KGQQI+EL Sbjct: 226 QRSSVNKSIHAKLVKPNTMIFNLVLDACVRFKLSFKGQQIMEL 268