BLASTX nr result
ID: Angelica27_contig00029951
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00029951 (539 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010260125.1 PREDICTED: mitochondrial import receptor subunit ... 68 3e-12 OIW19666.1 hypothetical protein TanjilG_18476 [Lupinus angustifo... 66 1e-11 XP_016666720.1 PREDICTED: mitochondrial import receptor subunit ... 66 2e-11 XP_014507906.1 PREDICTED: mitochondrial import receptor subunit ... 65 4e-11 XP_007155228.1 hypothetical protein PHAVU_003G184100g [Phaseolus... 65 4e-11 XP_015067639.1 PREDICTED: mitochondrial import receptor subunit ... 64 7e-11 XP_012470832.1 PREDICTED: mitochondrial import receptor subunit ... 64 7e-11 OAY47495.1 hypothetical protein MANES_06G083900 [Manihot esculenta] 64 1e-10 KYP56703.1 hypothetical protein KK1_002948 [Cajanus cajan] 64 1e-10 XP_017429019.1 PREDICTED: mitochondrial import receptor subunit ... 64 1e-10 XP_004236055.1 PREDICTED: mitochondrial import receptor subunit ... 64 1e-10 XP_015943477.1 PREDICTED: mitochondrial import receptor subunit ... 63 2e-10 OMO79686.1 hypothetical protein COLO4_24344 [Corchorus olitorius] 63 3e-10 XP_007037583.1 PREDICTED: mitochondrial import receptor subunit ... 63 3e-10 XP_003549571.1 PREDICTED: mitochondrial import receptor subunit ... 62 4e-10 XP_019235412.1 PREDICTED: mitochondrial import receptor subunit ... 62 5e-10 XP_009758470.1 PREDICTED: mitochondrial import receptor subunit ... 62 5e-10 XP_006345118.1 PREDICTED: mitochondrial import receptor subunit ... 62 5e-10 XP_016563326.1 PREDICTED: mitochondrial import receptor subunit ... 61 1e-09 XP_011072883.1 PREDICTED: mitochondrial import receptor subunit ... 61 1e-09 >XP_010260125.1 PREDICTED: mitochondrial import receptor subunit TOM5 homolog [Nelumbo nucifera] Length = 54 Score = 67.8 bits (164), Expect = 3e-12 Identities = 33/54 (61%), Positives = 42/54 (77%), Gaps = 7/54 (12%) Frame = -1 Query: 413 MADSIVSIQKVKDFWNSEVKNK-------KFLRAVGLFAGSIVFMRNFGDIMAI 273 MADS +S++K+K+FWNS+V+N+ K LRA GLFAGSI MRNFGD+MAI Sbjct: 1 MADSTISMEKLKEFWNSQVQNEEKWALNMKLLRAAGLFAGSIFLMRNFGDLMAI 54 >OIW19666.1 hypothetical protein TanjilG_18476 [Lupinus angustifolius] Length = 54 Score = 66.2 bits (160), Expect = 1e-11 Identities = 35/54 (64%), Positives = 41/54 (75%), Gaps = 7/54 (12%) Frame = -1 Query: 413 MADSIVSIQKVKDFWNSEVK-------NKKFLRAVGLFAGSIVFMRNFGDIMAI 273 MADS+VSIQ VKDF NS++ N K LRA+GLFAGSIV MRN+GD+MAI Sbjct: 1 MADSVVSIQYVKDFINSQIHDDEKWAFNSKLLRALGLFAGSIVLMRNYGDLMAI 54 >XP_016666720.1 PREDICTED: mitochondrial import receptor subunit TOM5 homolog [Gossypium hirsutum] XP_017628291.1 PREDICTED: mitochondrial import receptor subunit TOM5 homolog [Gossypium arboreum] KHG05467.1 Mitochondrial import receptor subunit TOM5 -like protein [Gossypium arboreum] Length = 54 Score = 65.9 bits (159), Expect = 2e-11 Identities = 32/54 (59%), Positives = 41/54 (75%), Gaps = 7/54 (12%) Frame = -1 Query: 413 MADSIVSIQKVKDFWNSEVK-------NKKFLRAVGLFAGSIVFMRNFGDIMAI 273 MAD+++S+ K+K FWNS+V N K LRAVGLFAGSI+ MRN+GD+MAI Sbjct: 1 MADTVISLDKLKAFWNSQVHDEENWAHNMKLLRAVGLFAGSILLMRNYGDLMAI 54 >XP_014507906.1 PREDICTED: mitochondrial import receptor subunit TOM5 homolog [Vigna radiata var. radiata] Length = 54 Score = 65.1 bits (157), Expect = 4e-11 Identities = 34/54 (62%), Positives = 41/54 (75%), Gaps = 7/54 (12%) Frame = -1 Query: 413 MADSIVSIQKVKDFWNSEVK-------NKKFLRAVGLFAGSIVFMRNFGDIMAI 273 MADS+VSIQ +KDF+NS++ N K LRA GLFAGSIV MRN+GD+MAI Sbjct: 1 MADSVVSIQYLKDFFNSQIYDDEKWAFNVKLLRAAGLFAGSIVLMRNYGDLMAI 54 >XP_007155228.1 hypothetical protein PHAVU_003G184100g [Phaseolus vulgaris] ESW27222.1 hypothetical protein PHAVU_003G184100g [Phaseolus vulgaris] Length = 54 Score = 65.1 bits (157), Expect = 4e-11 Identities = 34/54 (62%), Positives = 41/54 (75%), Gaps = 7/54 (12%) Frame = -1 Query: 413 MADSIVSIQKVKDFWNSEVK-------NKKFLRAVGLFAGSIVFMRNFGDIMAI 273 MADS+VSIQ +KDF+NS++ N K LRA GLFAGSIV MRN+GD+MAI Sbjct: 1 MADSVVSIQYLKDFFNSQIYDDEKWAFNVKMLRAAGLFAGSIVLMRNYGDLMAI 54 >XP_015067639.1 PREDICTED: mitochondrial import receptor subunit TOM5 homolog [Solanum pennellii] Length = 54 Score = 64.3 bits (155), Expect = 7e-11 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 7/54 (12%) Frame = -1 Query: 413 MADSIVSIQKVKDFWNSEVK-------NKKFLRAVGLFAGSIVFMRNFGDIMAI 273 MADS++S++KVK FW+S+V NKK LRA LFAGSI+ MR +GD+MAI Sbjct: 1 MADSVISVEKVKAFWHSQVHDEEKWNLNKKLLRATALFAGSIILMRQYGDLMAI 54 >XP_012470832.1 PREDICTED: mitochondrial import receptor subunit TOM5 homolog [Gossypium raimondii] XP_016740031.1 PREDICTED: mitochondrial import receptor subunit TOM5 homolog [Gossypium hirsutum] KJB19429.1 hypothetical protein B456_003G101600 [Gossypium raimondii] Length = 54 Score = 64.3 bits (155), Expect = 7e-11 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 7/54 (12%) Frame = -1 Query: 413 MADSIVSIQKVKDFWNSEVK-------NKKFLRAVGLFAGSIVFMRNFGDIMAI 273 MAD+++S+ K+K FWNS+V N K LRA GLFAGSI+ MRN+GD+MAI Sbjct: 1 MADTVISLDKLKAFWNSQVHDEENWAHNMKLLRAAGLFAGSILLMRNYGDLMAI 54 >OAY47495.1 hypothetical protein MANES_06G083900 [Manihot esculenta] Length = 54 Score = 63.9 bits (154), Expect = 1e-10 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 7/54 (12%) Frame = -1 Query: 413 MADSIVSIQKVKDFWNSEVK-------NKKFLRAVGLFAGSIVFMRNFGDIMAI 273 MADS+VS++K+K FWNS++ N K LRA GLFAGSI MRN+GD+MAI Sbjct: 1 MADSVVSLEKLKAFWNSQIYDEEKWALNMKLLRAGGLFAGSIFLMRNYGDLMAI 54 >KYP56703.1 hypothetical protein KK1_002948 [Cajanus cajan] Length = 54 Score = 63.5 bits (153), Expect = 1e-10 Identities = 34/54 (62%), Positives = 40/54 (74%), Gaps = 7/54 (12%) Frame = -1 Query: 413 MADSIVSIQKVKDFWNSEVK-------NKKFLRAVGLFAGSIVFMRNFGDIMAI 273 MADS+VSIQ +KDF NS++ N K LRA GLFAGSIV MRN+GD+MAI Sbjct: 1 MADSVVSIQYLKDFVNSQIYDDEKWAFNVKLLRAAGLFAGSIVLMRNYGDLMAI 54 >XP_017429019.1 PREDICTED: mitochondrial import receptor subunit TOM5 homolog [Vigna angularis] BAT76513.1 hypothetical protein VIGAN_01453000 [Vigna angularis var. angularis] Length = 54 Score = 63.5 bits (153), Expect = 1e-10 Identities = 33/54 (61%), Positives = 40/54 (74%), Gaps = 7/54 (12%) Frame = -1 Query: 413 MADSIVSIQKVKDFWNSEVK-------NKKFLRAVGLFAGSIVFMRNFGDIMAI 273 MADS+VSIQ +KDF+NS++ N K LRA GLF GSIV MRN+GD+MAI Sbjct: 1 MADSVVSIQYLKDFFNSQIYDDEKWAFNVKLLRAAGLFGGSIVLMRNYGDLMAI 54 >XP_004236055.1 PREDICTED: mitochondrial import receptor subunit TOM5 homolog [Solanum lycopersicum] Length = 54 Score = 63.5 bits (153), Expect = 1e-10 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 7/54 (12%) Frame = -1 Query: 413 MADSIVSIQKVKDFWNSEVK-------NKKFLRAVGLFAGSIVFMRNFGDIMAI 273 MADS++S+ KVK FW+S+V NKK LRA LFAGSI+ MR +GD+MAI Sbjct: 1 MADSVISVDKVKAFWHSQVHDEEKWNLNKKLLRATALFAGSIILMRQYGDLMAI 54 >XP_015943477.1 PREDICTED: mitochondrial import receptor subunit TOM5 homolog [Arachis duranensis] XP_016177071.1 PREDICTED: mitochondrial import receptor subunit TOM5 homolog [Arachis ipaensis] Length = 54 Score = 63.2 bits (152), Expect = 2e-10 Identities = 32/54 (59%), Positives = 41/54 (75%), Gaps = 7/54 (12%) Frame = -1 Query: 413 MADSIVSIQKVKDFWNSEVK-------NKKFLRAVGLFAGSIVFMRNFGDIMAI 273 MADS++S+Q +KDF S++ NKK LRA+GLFAGSIV MRN+GD+MAI Sbjct: 1 MADSVISVQYLKDFVCSQINDDEKWAFNKKLLRAMGLFAGSIVLMRNYGDLMAI 54 >OMO79686.1 hypothetical protein COLO4_24344 [Corchorus olitorius] Length = 54 Score = 62.8 bits (151), Expect = 3e-10 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 7/54 (12%) Frame = -1 Query: 413 MADSIVSIQKVKDFWNSEVK-------NKKFLRAVGLFAGSIVFMRNFGDIMAI 273 MA+S++S+ KVK FWNS+V N K LRA GLFAGSI MRN+GD+MA+ Sbjct: 1 MANSVLSLDKVKAFWNSQVHDEEKWAANMKLLRAAGLFAGSIFLMRNYGDLMAV 54 >XP_007037583.1 PREDICTED: mitochondrial import receptor subunit TOM5 homolog [Theobroma cacao] EOY22084.1 Mitochondrial import receptor subunit TOM5 [Theobroma cacao] Length = 54 Score = 62.8 bits (151), Expect = 3e-10 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 7/54 (12%) Frame = -1 Query: 413 MADSIVSIQKVKDFWNSEVK-------NKKFLRAVGLFAGSIVFMRNFGDIMAI 273 MAD ++SI KVK FW+S+V N K LRA GLFAGSI MRN+GD+MAI Sbjct: 1 MADPVISIDKVKAFWHSQVHDEEKWALNMKLLRAAGLFAGSIFLMRNYGDLMAI 54 >XP_003549571.1 PREDICTED: mitochondrial import receptor subunit TOM5 homolog [Glycine max] KHN18363.1 Mitochondrial import receptor subunit TOM5 like [Glycine soja] KHN48748.1 Mitochondrial import receptor subunit TOM5 like [Glycine soja] KRH03142.1 hypothetical protein GLYMA_17G079100 [Glycine max] KRH56803.1 hypothetical protein GLYMA_05G020300 [Glycine max] Length = 54 Score = 62.4 bits (150), Expect = 4e-10 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 7/54 (12%) Frame = -1 Query: 413 MADSIVSIQKVKDFWNSEVK-------NKKFLRAVGLFAGSIVFMRNFGDIMAI 273 MADS++SIQ +KDF NS++ N K LRA GLFAGSI+ MRN+GD+MAI Sbjct: 1 MADSVISIQYLKDFVNSQIYDDEKWAFNAKLLRAAGLFAGSILLMRNYGDLMAI 54 >XP_019235412.1 PREDICTED: mitochondrial import receptor subunit TOM5 homolog [Nicotiana attenuata] Length = 54 Score = 62.0 bits (149), Expect = 5e-10 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 7/54 (12%) Frame = -1 Query: 413 MADSIVSIQKVKDFWNSEVK-------NKKFLRAVGLFAGSIVFMRNFGDIMAI 273 MADS++S+ KVK FWNS+V N K LRA LFAGSI+ MR +GD+MAI Sbjct: 1 MADSVISLDKVKAFWNSQVHDEEKWNLNMKLLRASALFAGSIILMRQYGDLMAI 54 >XP_009758470.1 PREDICTED: mitochondrial import receptor subunit TOM5 homolog [Nicotiana sylvestris] XP_016446111.1 PREDICTED: mitochondrial import receptor subunit TOM5 homolog [Nicotiana tabacum] Length = 54 Score = 62.0 bits (149), Expect = 5e-10 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 7/54 (12%) Frame = -1 Query: 413 MADSIVSIQKVKDFWNSEVK-------NKKFLRAVGLFAGSIVFMRNFGDIMAI 273 MADS++S+ KVK FWNS+V N K LRA LFAGSI+ MR +GD+MAI Sbjct: 1 MADSVISLNKVKAFWNSQVHDEEKWNLNMKLLRASALFAGSIILMRQYGDLMAI 54 >XP_006345118.1 PREDICTED: mitochondrial import receptor subunit TOM5 homolog [Solanum tuberosum] Length = 54 Score = 62.0 bits (149), Expect = 5e-10 Identities = 30/54 (55%), Positives = 38/54 (70%), Gaps = 7/54 (12%) Frame = -1 Query: 413 MADSIVSIQKVKDFWNSEVK-------NKKFLRAVGLFAGSIVFMRNFGDIMAI 273 M DS++S+ KVK FW+S+V NKK LRA LFAGSI+ MR +GD+MAI Sbjct: 1 MVDSVISVDKVKAFWHSQVHDEERWNLNKKLLRATALFAGSIILMRQYGDLMAI 54 >XP_016563326.1 PREDICTED: mitochondrial import receptor subunit TOM5 homolog [Capsicum annuum] Length = 54 Score = 61.2 bits (147), Expect = 1e-09 Identities = 29/54 (53%), Positives = 40/54 (74%), Gaps = 7/54 (12%) Frame = -1 Query: 413 MADSIVSIQKVKDFWNSEVK-------NKKFLRAVGLFAGSIVFMRNFGDIMAI 273 MA S++S++KVK+FW+++V NKK LRA LFAGSI+ MR +GD+MAI Sbjct: 1 MAYSVISVEKVKEFWHAQVHDEDKWNLNKKLLRATALFAGSIILMRQYGDLMAI 54 >XP_011072883.1 PREDICTED: mitochondrial import receptor subunit TOM5 homolog [Sesamum indicum] Length = 54 Score = 61.2 bits (147), Expect = 1e-09 Identities = 30/54 (55%), Positives = 38/54 (70%), Gaps = 7/54 (12%) Frame = -1 Query: 413 MADSIVSIQKVKDFWNSEVK-------NKKFLRAVGLFAGSIVFMRNFGDIMAI 273 MAD ++S+ K+K FW+S+ N K LRAVGLFAGSIV MR +GD+MAI Sbjct: 1 MADKVISVDKIKAFWHSQFHDPDKWDLNMKLLRAVGLFAGSIVLMRQYGDMMAI 54