BLASTX nr result
ID: Angelica27_contig00029873
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00029873 (308 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN10004.1 hypothetical protein DCAR_002660 [Daucus carota subsp... 54 3e-06 XP_017240943.1 PREDICTED: probable serine/threonine-protein kina... 54 3e-06 XP_017240936.1 PREDICTED: probable serine/threonine-protein kina... 54 3e-06 >KZN10004.1 hypothetical protein DCAR_002660 [Daucus carota subsp. sativus] Length = 754 Score = 53.9 bits (128), Expect = 3e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +1 Query: 196 QEENHLSIGGIQDRSRSAADCINNNSASLLLYQSNHV 306 QEENH+S G IQD+ RSAADC+NNNSASL LY+S V Sbjct: 125 QEENHVSFG-IQDQPRSAADCMNNNSASLSLYRSEQV 160 >XP_017240943.1 PREDICTED: probable serine/threonine-protein kinase mps1 isoform X2 [Daucus carota subsp. sativus] Length = 802 Score = 53.9 bits (128), Expect = 3e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +1 Query: 196 QEENHLSIGGIQDRSRSAADCINNNSASLLLYQSNHV 306 QEENH+S G IQD+ RSAADC+NNNSASL LY+S V Sbjct: 125 QEENHVSFG-IQDQPRSAADCMNNNSASLSLYRSEQV 160 >XP_017240936.1 PREDICTED: probable serine/threonine-protein kinase mps1 isoform X1 [Daucus carota subsp. sativus] Length = 827 Score = 53.9 bits (128), Expect = 3e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +1 Query: 196 QEENHLSIGGIQDRSRSAADCINNNSASLLLYQSNHV 306 QEENH+S G IQD+ RSAADC+NNNSASL LY+S V Sbjct: 150 QEENHVSFG-IQDQPRSAADCMNNNSASLSLYRSEQV 185