BLASTX nr result
ID: Angelica27_contig00029864
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00029864 (296 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017251234.1 PREDICTED: DIS3-like exonuclease 2 isoform X1 [Da... 54 3e-06 >XP_017251234.1 PREDICTED: DIS3-like exonuclease 2 isoform X1 [Daucus carota subsp. sativus] KZM94147.1 hypothetical protein DCAR_017392 [Daucus carota subsp. sativus] Length = 1083 Score = 53.9 bits (128), Expect = 3e-06 Identities = 26/44 (59%), Positives = 29/44 (65%) Frame = +3 Query: 12 NQLVEGDIVLI*MDSLSSWTKMKGXXXXXXXXXXXEVCDLVPEP 143 N+ +EGDIVLI +D LSSWTKMKG VCDLVPEP Sbjct: 192 NRAIEGDIVLIKIDPLSSWTKMKGSSGPSNSAAVSHVCDLVPEP 235