BLASTX nr result
ID: Angelica27_contig00029546
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00029546 (339 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017238082.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 130 3e-34 ALD47591.1 BTB/POZ and TAZ domain-containing protein [Lonicera j... 119 7e-30 XP_010679626.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 111 5e-27 XP_009759977.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 110 1e-26 OIT37799.1 btbpoz and taz domain-containing protein 4 [Nicotiana... 107 2e-26 OAY33639.1 hypothetical protein MANES_13G112500 [Manihot esculenta] 109 3e-26 XP_019266630.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 109 3e-26 XP_016479665.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 109 3e-26 XP_009604071.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 109 3e-26 XP_009587549.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 107 2e-25 XP_016560955.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 107 2e-25 XP_015578516.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 104 3e-25 XP_016441815.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 106 3e-25 XP_019195495.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 106 4e-25 XP_015064154.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 106 5e-25 XP_010316014.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 106 5e-25 XP_018854544.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 100 6e-25 XP_009787049.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 105 1e-24 EEF37093.1 transcription cofactor, putative [Ricinus communis] 104 2e-24 XP_006380615.1 hypothetical protein POPTR_0007s09840g [Populus t... 104 2e-24 >XP_017238082.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Daucus carota subsp. sativus] Length = 373 Score = 130 bits (327), Expect = 3e-34 Identities = 59/67 (88%), Positives = 64/67 (95%) Frame = +2 Query: 2 CKRMWQLLELHSRLCADSDMCRVPLCRTLKYRTTKLNKKEDMKWRILVKKVSRTKSISGA 181 CKRMWQLLELHS LCADSDMC+VPLCRTLKYRTT ++KKEDMKWRILV+K+SRTKSISGA Sbjct: 303 CKRMWQLLELHSHLCADSDMCKVPLCRTLKYRTTNVSKKEDMKWRILVRKISRTKSISGA 362 Query: 182 PFFSLAT 202 PFFS AT Sbjct: 363 PFFSFAT 369 >ALD47591.1 BTB/POZ and TAZ domain-containing protein [Lonicera japonica] Length = 371 Score = 119 bits (297), Expect = 7e-30 Identities = 54/67 (80%), Positives = 60/67 (89%) Frame = +2 Query: 2 CKRMWQLLELHSRLCADSDMCRVPLCRTLKYRTTKLNKKEDMKWRILVKKVSRTKSISGA 181 CKRMWQLLELHSRLCADSDMCRVPLCR K + K NKK++MKWRILV+K+ RTKSISGA Sbjct: 304 CKRMWQLLELHSRLCADSDMCRVPLCRNFKQKRRKQNKKDEMKWRILVRKILRTKSISGA 363 Query: 182 PFFSLAT 202 PFFSLA+ Sbjct: 364 PFFSLAS 370 >XP_010679626.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4 [Beta vulgaris subsp. vulgaris] KMT09833.1 hypothetical protein BVRB_6g128090 [Beta vulgaris subsp. vulgaris] Length = 388 Score = 111 bits (278), Expect = 5e-27 Identities = 49/66 (74%), Positives = 58/66 (87%) Frame = +2 Query: 2 CKRMWQLLELHSRLCADSDMCRVPLCRTLKYRTTKLNKKEDMKWRILVKKVSRTKSISGA 181 CKRMW+L ELHSRLC DSD+CRVPLCR K R+ KLNKKEDM+W+IL +K+ R++SISGA Sbjct: 320 CKRMWKLFELHSRLCIDSDVCRVPLCRNFKDRSMKLNKKEDMRWKILARKIVRSRSISGA 379 Query: 182 PFFSLA 199 PFFSLA Sbjct: 380 PFFSLA 385 >XP_009759977.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana sylvestris] XP_009759978.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana sylvestris] XP_009759979.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana sylvestris] XP_016434919.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tabacum] XP_016434920.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tabacum] XP_016434921.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tabacum] XP_016434922.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tabacum] XP_016434923.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tabacum] XP_016434924.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tabacum] Length = 379 Score = 110 bits (275), Expect = 1e-26 Identities = 48/64 (75%), Positives = 58/64 (90%) Frame = +2 Query: 2 CKRMWQLLELHSRLCADSDMCRVPLCRTLKYRTTKLNKKEDMKWRILVKKVSRTKSISGA 181 CKRMWQ+LELHSRLCA+SD+CRVPLCR K + K NKK++MKWRILV+K++R+KSISGA Sbjct: 312 CKRMWQVLELHSRLCANSDVCRVPLCRNFKQKRRKQNKKDEMKWRILVRKIARSKSISGA 371 Query: 182 PFFS 193 PFFS Sbjct: 372 PFFS 375 >OIT37799.1 btbpoz and taz domain-containing protein 4 [Nicotiana attenuata] Length = 241 Score = 107 bits (266), Expect = 2e-26 Identities = 47/65 (72%), Positives = 56/65 (86%) Frame = +2 Query: 2 CKRMWQLLELHSRLCADSDMCRVPLCRTLKYRTTKLNKKEDMKWRILVKKVSRTKSISGA 181 CKRMWQ+LELHSRLCADSD+CRVPLCR K R + KK+++KWRILV+K+ R+KSISG Sbjct: 174 CKRMWQVLELHSRLCADSDVCRVPLCRNFKQRRRRQKKKDEIKWRILVRKIVRSKSISGM 233 Query: 182 PFFSL 196 PFFSL Sbjct: 234 PFFSL 238 >OAY33639.1 hypothetical protein MANES_13G112500 [Manihot esculenta] Length = 378 Score = 109 bits (272), Expect = 3e-26 Identities = 49/66 (74%), Positives = 56/66 (84%) Frame = +2 Query: 2 CKRMWQLLELHSRLCADSDMCRVPLCRTLKYRTTKLNKKEDMKWRILVKKVSRTKSISGA 181 CKRMWQLLELHSRLCADS++CRVPLCR K R K NKK+++KWRILVKK+ RTK I + Sbjct: 308 CKRMWQLLELHSRLCADSNLCRVPLCRNFKVRIRKQNKKDEVKWRILVKKILRTKRIGSS 367 Query: 182 PFFSLA 199 PFFSLA Sbjct: 368 PFFSLA 373 >XP_019266630.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4 [Nicotiana attenuata] OIT34921.1 btbpoz and taz domain-containing protein 4 [Nicotiana attenuata] Length = 379 Score = 109 bits (272), Expect = 3e-26 Identities = 48/64 (75%), Positives = 57/64 (89%) Frame = +2 Query: 2 CKRMWQLLELHSRLCADSDMCRVPLCRTLKYRTTKLNKKEDMKWRILVKKVSRTKSISGA 181 CKRMWQ+LELHSRLCA+SD+CRVPLCR K + K NKK++MKWRILV+K+ R+KSISGA Sbjct: 312 CKRMWQVLELHSRLCANSDVCRVPLCRNFKQKRRKQNKKDEMKWRILVRKIVRSKSISGA 371 Query: 182 PFFS 193 PFFS Sbjct: 372 PFFS 375 >XP_016479665.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tabacum] Length = 380 Score = 109 bits (272), Expect = 3e-26 Identities = 48/64 (75%), Positives = 57/64 (89%) Frame = +2 Query: 2 CKRMWQLLELHSRLCADSDMCRVPLCRTLKYRTTKLNKKEDMKWRILVKKVSRTKSISGA 181 CKRMWQ+LELHSRLCA+SD+CRVPLCR K + K NKK++MKWRILV+K+ R+KSISGA Sbjct: 313 CKRMWQVLELHSRLCANSDVCRVPLCRNFKQKRRKQNKKDEMKWRILVRKIVRSKSISGA 372 Query: 182 PFFS 193 PFFS Sbjct: 373 PFFS 376 >XP_009604071.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tomentosiformis] XP_009604072.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tomentosiformis] XP_018627202.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tomentosiformis] Length = 380 Score = 109 bits (272), Expect = 3e-26 Identities = 48/64 (75%), Positives = 57/64 (89%) Frame = +2 Query: 2 CKRMWQLLELHSRLCADSDMCRVPLCRTLKYRTTKLNKKEDMKWRILVKKVSRTKSISGA 181 CKRMWQ+LELHSRLCA+SD+CRVPLCR K + K NKK++MKWRILV+K+ R+KSISGA Sbjct: 313 CKRMWQVLELHSRLCANSDVCRVPLCRNFKQKRRKQNKKDEMKWRILVRKIVRSKSISGA 372 Query: 182 PFFS 193 PFFS Sbjct: 373 PFFS 376 >XP_009587549.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tomentosiformis] XP_009587550.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tomentosiformis] Length = 370 Score = 107 bits (267), Expect = 2e-25 Identities = 47/67 (70%), Positives = 57/67 (85%) Frame = +2 Query: 2 CKRMWQLLELHSRLCADSDMCRVPLCRTLKYRTTKLNKKEDMKWRILVKKVSRTKSISGA 181 CKRMWQ+LELHSRLC+DSD+CRVPLCR K R + KK+++KWRILVKK+ R+KSISG Sbjct: 303 CKRMWQVLELHSRLCSDSDVCRVPLCRNFKQRRRRQKKKDEIKWRILVKKIVRSKSISGM 362 Query: 182 PFFSLAT 202 PFFSL + Sbjct: 363 PFFSLGS 369 >XP_016560955.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4 [Capsicum annuum] XP_016560956.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4 [Capsicum annuum] Length = 379 Score = 107 bits (267), Expect = 2e-25 Identities = 47/64 (73%), Positives = 56/64 (87%) Frame = +2 Query: 2 CKRMWQLLELHSRLCADSDMCRVPLCRTLKYRTTKLNKKEDMKWRILVKKVSRTKSISGA 181 CKRMWQ+LELHSRLCA+ D+CRVPLCR K + K NKK++MKWRILV+K+ R+KSISGA Sbjct: 312 CKRMWQILELHSRLCANLDVCRVPLCRNFKQKRRKQNKKDEMKWRILVRKIVRSKSISGA 371 Query: 182 PFFS 193 PFFS Sbjct: 372 PFFS 375 >XP_015578516.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4 [Ricinus communis] Length = 246 Score = 104 bits (259), Expect = 3e-25 Identities = 46/66 (69%), Positives = 55/66 (83%) Frame = +2 Query: 2 CKRMWQLLELHSRLCADSDMCRVPLCRTLKYRTTKLNKKEDMKWRILVKKVSRTKSISGA 181 CKRMWQLLELHSRLCADSD CRVPLC+ K R + +KK+++KWRILVKK+ RTK I G+ Sbjct: 176 CKRMWQLLELHSRLCADSDACRVPLCKNFKARIKRQSKKDEIKWRILVKKIIRTKRIGGS 235 Query: 182 PFFSLA 199 PFF+ A Sbjct: 236 PFFTSA 241 >XP_016441815.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tabacum] XP_016441821.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tabacum] Length = 371 Score = 106 bits (265), Expect = 3e-25 Identities = 47/65 (72%), Positives = 55/65 (84%) Frame = +2 Query: 2 CKRMWQLLELHSRLCADSDMCRVPLCRTLKYRTTKLNKKEDMKWRILVKKVSRTKSISGA 181 CKRMWQ+LELHSRLCADSD CRVPLCR K R + KK+++KWRILV+K+ R+KSISG Sbjct: 304 CKRMWQVLELHSRLCADSDFCRVPLCRNFKQRRRRQKKKDEIKWRILVRKIVRSKSISGM 363 Query: 182 PFFSL 196 PFFSL Sbjct: 364 PFFSL 368 >XP_019195495.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like isoform X1 [Ipomoea nil] Length = 373 Score = 106 bits (264), Expect = 4e-25 Identities = 46/65 (70%), Positives = 56/65 (86%) Frame = +2 Query: 2 CKRMWQLLELHSRLCADSDMCRVPLCRTLKYRTTKLNKKEDMKWRILVKKVSRTKSISGA 181 CKRMWQ+ ELHSRLCADSD C+VPLCR K + K NKK++MKW+ILV+K+ R+KSISGA Sbjct: 306 CKRMWQVFELHSRLCADSDNCKVPLCRNFKEKMRKQNKKDEMKWKILVRKIVRSKSISGA 365 Query: 182 PFFSL 196 PFFS+ Sbjct: 366 PFFSV 370 >XP_015064154.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4 [Solanum pennellii] Length = 379 Score = 106 bits (264), Expect = 5e-25 Identities = 46/64 (71%), Positives = 57/64 (89%) Frame = +2 Query: 2 CKRMWQLLELHSRLCADSDMCRVPLCRTLKYRTTKLNKKEDMKWRILVKKVSRTKSISGA 181 CKRMWQ+LELHSRLCA+SD+C+VPLCR+ K + K NKK++MKW ILV+K+ R+KSISGA Sbjct: 312 CKRMWQVLELHSRLCANSDVCKVPLCRSFKQKRRKQNKKDEMKWSILVRKIVRSKSISGA 371 Query: 182 PFFS 193 PFFS Sbjct: 372 PFFS 375 >XP_010316014.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4 [Solanum lycopersicum] Length = 379 Score = 106 bits (264), Expect = 5e-25 Identities = 46/64 (71%), Positives = 57/64 (89%) Frame = +2 Query: 2 CKRMWQLLELHSRLCADSDMCRVPLCRTLKYRTTKLNKKEDMKWRILVKKVSRTKSISGA 181 CKRMWQ+LELHSRLCA+SD+C+VPLCR+ K + K NKK++MKW ILV+K+ R+KSISGA Sbjct: 312 CKRMWQVLELHSRLCANSDVCKVPLCRSFKQKRRKQNKKDEMKWSILVRKIVRSKSISGA 371 Query: 182 PFFS 193 PFFS Sbjct: 372 PFFS 375 >XP_018854544.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Juglans regia] Length = 149 Score = 100 bits (250), Expect = 6e-25 Identities = 45/64 (70%), Positives = 53/64 (82%) Frame = +2 Query: 2 CKRMWQLLELHSRLCADSDMCRVPLCRTLKYRTTKLNKKEDMKWRILVKKVSRTKSISGA 181 CKRMWQLLELHSRLC +SD+CRVPLCR K R + +KK+++KWRILVKK+ RT I GA Sbjct: 79 CKRMWQLLELHSRLCTNSDVCRVPLCRNFKERIRRQSKKDEIKWRILVKKILRTVPIVGA 138 Query: 182 PFFS 193 PFFS Sbjct: 139 PFFS 142 >XP_009787049.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana sylvestris] XP_009787050.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana sylvestris] Length = 371 Score = 105 bits (261), Expect = 1e-24 Identities = 46/65 (70%), Positives = 55/65 (84%) Frame = +2 Query: 2 CKRMWQLLELHSRLCADSDMCRVPLCRTLKYRTTKLNKKEDMKWRILVKKVSRTKSISGA 181 CKR+WQ+LELHSRLCADSD CRVPLCR K R + KK+++KWRILV+K+ R+KSISG Sbjct: 304 CKRIWQVLELHSRLCADSDFCRVPLCRNFKQRRRRQKKKDEIKWRILVRKIVRSKSISGM 363 Query: 182 PFFSL 196 PFFSL Sbjct: 364 PFFSL 368 >EEF37093.1 transcription cofactor, putative [Ricinus communis] Length = 347 Score = 104 bits (259), Expect = 2e-24 Identities = 46/66 (69%), Positives = 55/66 (83%) Frame = +2 Query: 2 CKRMWQLLELHSRLCADSDMCRVPLCRTLKYRTTKLNKKEDMKWRILVKKVSRTKSISGA 181 CKRMWQLLELHSRLCADSD CRVPLC+ K R + +KK+++KWRILVKK+ RTK I G+ Sbjct: 277 CKRMWQLLELHSRLCADSDACRVPLCKNFKARIKRQSKKDEIKWRILVKKIIRTKRIGGS 336 Query: 182 PFFSLA 199 PFF+ A Sbjct: 337 PFFTSA 342 >XP_006380615.1 hypothetical protein POPTR_0007s09840g [Populus trichocarpa] ERP58412.1 hypothetical protein POPTR_0007s09840g [Populus trichocarpa] Length = 380 Score = 104 bits (260), Expect = 2e-24 Identities = 46/66 (69%), Positives = 55/66 (83%) Frame = +2 Query: 2 CKRMWQLLELHSRLCADSDMCRVPLCRTLKYRTTKLNKKEDMKWRILVKKVSRTKSISGA 181 CKRMWQLLELHSRLC DS+ CRVPLCR K RT K +KK++++WRILVK + +TKSI G+ Sbjct: 310 CKRMWQLLELHSRLCVDSEACRVPLCRNFKERTKKQSKKDEIRWRILVKNILKTKSIGGS 369 Query: 182 PFFSLA 199 PFFS A Sbjct: 370 PFFSSA 375