BLASTX nr result
ID: Angelica27_contig00028893
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00028893 (465 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM85996.1 hypothetical protein DCAR_026582 [Daucus carota subsp... 168 4e-46 XP_017222560.1 PREDICTED: pentatricopeptide repeat-containing pr... 168 1e-45 OAY49934.1 hypothetical protein MANES_05G095100 [Manihot esculenta] 128 2e-31 XP_015900996.1 PREDICTED: pentatricopeptide repeat-containing pr... 119 2e-31 KVI05594.1 hypothetical protein Ccrd_016082 [Cynara cardunculus ... 127 4e-31 XP_016492589.1 PREDICTED: pentatricopeptide repeat-containing pr... 126 6e-31 XP_009608961.1 PREDICTED: pentatricopeptide repeat-containing pr... 126 6e-31 GAV60264.1 PPR domain-containing protein/PPR_1 domain-containing... 121 4e-29 XP_016443751.1 PREDICTED: pentatricopeptide repeat-containing pr... 121 4e-29 XP_009770050.1 PREDICTED: pentatricopeptide repeat-containing pr... 121 4e-29 XP_006438545.1 hypothetical protein CICLE_v10030848mg [Citrus cl... 120 7e-29 KDO82695.1 hypothetical protein CISIN_1g004470mg [Citrus sinensis] 120 7e-29 XP_006483272.1 PREDICTED: pentatricopeptide repeat-containing pr... 120 7e-29 XP_015168807.1 PREDICTED: pentatricopeptide repeat-containing pr... 120 7e-29 XP_019230759.1 PREDICTED: pentatricopeptide repeat-containing pr... 120 8e-29 CBI32045.3 unnamed protein product, partial [Vitis vinifera] 120 8e-29 XP_002268680.2 PREDICTED: pentatricopeptide repeat-containing pr... 120 9e-29 XP_019230747.1 PREDICTED: pentatricopeptide repeat-containing pr... 120 9e-29 EEF42222.1 pentatricopeptide repeat-containing protein, putative... 120 1e-28 XP_019069568.1 PREDICTED: pentatricopeptide repeat-containing pr... 120 1e-28 >KZM85996.1 hypothetical protein DCAR_026582 [Daucus carota subsp. sativus] Length = 653 Score = 168 bits (425), Expect = 4e-46 Identities = 81/90 (90%), Positives = 87/90 (96%) Frame = +2 Query: 2 EAGFLHKEMIEKGHKLTVDSYNAIIKGYIKRKKYMEAAELFREMRSNGLVADRELYNTFM 181 EAG+L+KEMIEKG+KLTVDSYNAIIKGYIKRKK+ EAAELFREMR NGLVADRELYN FM Sbjct: 564 EAGYLYKEMIEKGYKLTVDSYNAIIKGYIKRKKFAEAAELFREMRRNGLVADRELYNIFM 623 Query: 182 ELNFHEGNVAMTIELCDETLENCLVDKTNS 271 ELNFHEGNVAMT+ELCDETLENCLVDKT+S Sbjct: 624 ELNFHEGNVAMTLELCDETLENCLVDKTDS 653 >XP_017222560.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Daucus carota subsp. sativus] XP_017222561.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Daucus carota subsp. sativus] Length = 750 Score = 168 bits (425), Expect = 1e-45 Identities = 81/90 (90%), Positives = 87/90 (96%) Frame = +2 Query: 2 EAGFLHKEMIEKGHKLTVDSYNAIIKGYIKRKKYMEAAELFREMRSNGLVADRELYNTFM 181 EAG+L+KEMIEKG+KLTVDSYNAIIKGYIKRKK+ EAAELFREMR NGLVADRELYN FM Sbjct: 661 EAGYLYKEMIEKGYKLTVDSYNAIIKGYIKRKKFAEAAELFREMRRNGLVADRELYNIFM 720 Query: 182 ELNFHEGNVAMTIELCDETLENCLVDKTNS 271 ELNFHEGNVAMT+ELCDETLENCLVDKT+S Sbjct: 721 ELNFHEGNVAMTLELCDETLENCLVDKTDS 750 >OAY49934.1 hypothetical protein MANES_05G095100 [Manihot esculenta] Length = 750 Score = 128 bits (321), Expect = 2e-31 Identities = 57/92 (61%), Positives = 73/92 (79%) Frame = +2 Query: 2 EAGFLHKEMIEKGHKLTVDSYNAIIKGYIKRKKYMEAAELFREMRSNGLVADRELYNTFM 181 EA FLHKEM+EKG LT SYNA+IKG++KRKK +EA +LF EMR GLVAD E+YN F+ Sbjct: 658 EAWFLHKEMVEKGFNLTASSYNALIKGFLKRKKLLEARQLFEEMRRKGLVADAEIYNLFV 717 Query: 182 ELNFHEGNVAMTIELCDETLENCLVDKTNSRN 277 ++N+ EGN+ T+ELCDE +ENCLVD+ + N Sbjct: 718 DINYEEGNLETTLELCDEAIENCLVDEARNGN 749 >XP_015900996.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Ziziphus jujuba] Length = 171 Score = 119 bits (299), Expect = 2e-31 Identities = 53/88 (60%), Positives = 69/88 (78%) Frame = +2 Query: 5 AGFLHKEMIEKGHKLTVDSYNAIIKGYIKRKKYMEAAELFREMRSNGLVADRELYNTFME 184 AGFLH+EM+ KG LT SYNA+IKG+ KRKK+ EA ELF EMR GL+ADRE+YN F++ Sbjct: 81 AGFLHEEMVAKGFLLTASSYNALIKGFYKRKKFAEARELFEEMRGQGLIADREIYNLFVD 140 Query: 185 LNFHEGNVAMTIELCDETLENCLVDKTN 268 + + EGN+ +T++LCDE +ENCLV N Sbjct: 141 MIYKEGNMEVTLDLCDEVIENCLVRSKN 168 >KVI05594.1 hypothetical protein Ccrd_016082 [Cynara cardunculus var. scolymus] Length = 816 Score = 127 bits (319), Expect = 4e-31 Identities = 57/86 (66%), Positives = 73/86 (84%) Frame = +2 Query: 2 EAGFLHKEMIEKGHKLTVDSYNAIIKGYIKRKKYMEAAELFREMRSNGLVADRELYNTFM 181 EA +LHKEM+EKG+ LTV +YNA+IKG+IKRKK++EA LF EMR GLVADRELYN FM Sbjct: 658 EAWYLHKEMVEKGYDLTVKAYNALIKGFIKRKKHLEAKNLFEEMRKKGLVADRELYNFFM 717 Query: 182 ELNFHEGNVAMTIELCDETLENCLVD 259 ++N+HEGN+ +T+ELCDE +E +VD Sbjct: 718 DMNYHEGNLDLTLELCDEAIEKRIVD 743 >XP_016492589.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Nicotiana tabacum] XP_016492590.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Nicotiana tabacum] XP_016492592.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Nicotiana tabacum] Length = 752 Score = 126 bits (317), Expect = 6e-31 Identities = 56/92 (60%), Positives = 75/92 (81%) Frame = +2 Query: 2 EAGFLHKEMIEKGHKLTVDSYNAIIKGYIKRKKYMEAAELFREMRSNGLVADRELYNTFM 181 EA FLHKEMI+KG TVD+Y+A+IKG++KRKKY EA E+F EMR NGL+AD+ELY+ F Sbjct: 660 EAWFLHKEMIKKGFTPTVDTYHALIKGFLKRKKYSEAKEMFEEMRRNGLLADKELYSIFA 719 Query: 182 ELNFHEGNVAMTIELCDETLENCLVDKTNSRN 277 ++N+ +GN + +ELCDE LE C+ DKT++RN Sbjct: 720 DMNYEQGNFDLALELCDEALEKCVADKTDNRN 751 >XP_009608961.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Nicotiana tomentosiformis] XP_009608967.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Nicotiana tomentosiformis] XP_009608980.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Nicotiana tomentosiformis] XP_018628517.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Nicotiana tomentosiformis] XP_018628522.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Nicotiana tomentosiformis] XP_018628523.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Nicotiana tomentosiformis] Length = 752 Score = 126 bits (317), Expect = 6e-31 Identities = 56/92 (60%), Positives = 75/92 (81%) Frame = +2 Query: 2 EAGFLHKEMIEKGHKLTVDSYNAIIKGYIKRKKYMEAAELFREMRSNGLVADRELYNTFM 181 EA FLHKEMI+KG TVD+Y+A+IKG++KRKKY EA E+F EMR NGL+AD+ELY+ F Sbjct: 660 EAWFLHKEMIKKGFTPTVDTYHALIKGFLKRKKYSEAKEMFEEMRRNGLLADKELYSIFA 719 Query: 182 ELNFHEGNVAMTIELCDETLENCLVDKTNSRN 277 ++N+ +GN + +ELCDE LE C+ DKT++RN Sbjct: 720 DMNYEQGNFDLALELCDEALEKCVADKTDNRN 751 >GAV60264.1 PPR domain-containing protein/PPR_1 domain-containing protein/PPR_2 domain-containing protein [Cephalotus follicularis] Length = 751 Score = 121 bits (304), Expect = 4e-29 Identities = 54/92 (58%), Positives = 73/92 (79%) Frame = +2 Query: 2 EAGFLHKEMIEKGHKLTVDSYNAIIKGYIKRKKYMEAAELFREMRSNGLVADRELYNTFM 181 EA FLHKEM KG KL+ SYNA+IKG+ KRKK++EA+ELF E+R GLVADRE+YN ++ Sbjct: 659 EAWFLHKEMACKGFKLSTSSYNALIKGFFKRKKFLEASELFEELRREGLVADREIYNFYV 718 Query: 182 ELNFHEGNVAMTIELCDETLENCLVDKTNSRN 277 ++N+ EGN+ T+ELCDE +E CL+ +T + N Sbjct: 719 DINYEEGNMETTLELCDEAIEKCLLGETKNGN 750 >XP_016443751.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Nicotiana tabacum] XP_016443752.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Nicotiana tabacum] XP_016443753.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Nicotiana tabacum] XP_016443754.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Nicotiana tabacum] XP_016443755.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Nicotiana tabacum] XP_016443756.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Nicotiana tabacum] XP_016443757.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Nicotiana tabacum] XP_016443758.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Nicotiana tabacum] XP_016443759.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Nicotiana tabacum] Length = 752 Score = 121 bits (304), Expect = 4e-29 Identities = 55/92 (59%), Positives = 73/92 (79%) Frame = +2 Query: 2 EAGFLHKEMIEKGHKLTVDSYNAIIKGYIKRKKYMEAAELFREMRSNGLVADRELYNTFM 181 EA FLHKEMI+KG TVD+Y+A+IKG++KRKKY EA E+F EMR GL+AD+ELY+ F Sbjct: 660 EAWFLHKEMIKKGFTPTVDTYHALIKGFLKRKKYSEAKEMFEEMRREGLLADKELYSIFA 719 Query: 182 ELNFHEGNVAMTIELCDETLENCLVDKTNSRN 277 ++N+ GN + +ELCDE LE C+ DKT++RN Sbjct: 720 DMNYELGNFDLALELCDEALEKCVSDKTDNRN 751 >XP_009770050.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Nicotiana sylvestris] XP_009770051.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Nicotiana sylvestris] XP_009770052.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Nicotiana sylvestris] XP_009770053.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Nicotiana sylvestris] XP_009770054.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Nicotiana sylvestris] XP_009770055.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Nicotiana sylvestris] XP_009770056.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Nicotiana sylvestris] XP_009770057.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Nicotiana sylvestris] XP_009770058.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Nicotiana sylvestris] XP_009770059.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Nicotiana sylvestris] XP_009770060.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Nicotiana sylvestris] XP_009770061.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Nicotiana sylvestris] XP_009770062.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Nicotiana sylvestris] Length = 752 Score = 121 bits (304), Expect = 4e-29 Identities = 55/92 (59%), Positives = 73/92 (79%) Frame = +2 Query: 2 EAGFLHKEMIEKGHKLTVDSYNAIIKGYIKRKKYMEAAELFREMRSNGLVADRELYNTFM 181 EA FLHKEMI+KG TVD+Y+A+IKG++KRKKY EA E+F EMR GL+AD+ELY+ F Sbjct: 660 EAWFLHKEMIKKGFTPTVDTYHALIKGFLKRKKYSEAKEMFEEMRREGLLADKELYSIFA 719 Query: 182 ELNFHEGNVAMTIELCDETLENCLVDKTNSRN 277 ++N+ GN + +ELCDE LE C+ DKT++RN Sbjct: 720 DMNYELGNFDLALELCDEALEKCVSDKTDNRN 751 >XP_006438545.1 hypothetical protein CICLE_v10030848mg [Citrus clementina] ESR51785.1 hypothetical protein CICLE_v10030848mg [Citrus clementina] Length = 703 Score = 120 bits (302), Expect = 7e-29 Identities = 56/92 (60%), Positives = 69/92 (75%) Frame = +2 Query: 2 EAGFLHKEMIEKGHKLTVDSYNAIIKGYIKRKKYMEAAELFREMRSNGLVADRELYNTFM 181 EA FLHKEM++KG LT SYNA+IKG++KRKKY+EA ELF EMR GLVADRE+Y F+ Sbjct: 611 EAWFLHKEMVQKGFNLTTSSYNALIKGFLKRKKYLEARELFEEMRRGGLVADREIYYFFV 670 Query: 182 ELNFHEGNVAMTIELCDETLENCLVDKTNSRN 277 ++NF EGN +T+ELCD +E LV K N Sbjct: 671 DINFEEGNTEITLELCDAAIECYLVGKATDEN 702 >KDO82695.1 hypothetical protein CISIN_1g004470mg [Citrus sinensis] Length = 751 Score = 120 bits (302), Expect = 7e-29 Identities = 56/92 (60%), Positives = 69/92 (75%) Frame = +2 Query: 2 EAGFLHKEMIEKGHKLTVDSYNAIIKGYIKRKKYMEAAELFREMRSNGLVADRELYNTFM 181 EA FLHKEM++KG LT SYNA+IKG++KRKKY+EA ELF EMR GLVADRE+Y F+ Sbjct: 659 EAWFLHKEMVQKGFNLTTSSYNALIKGFLKRKKYLEARELFEEMRRGGLVADREIYYFFV 718 Query: 182 ELNFHEGNVAMTIELCDETLENCLVDKTNSRN 277 ++NF EGN +T+ELCD +E LV K N Sbjct: 719 DINFEEGNTEITLELCDAAIECYLVGKATDEN 750 >XP_006483272.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Citrus sinensis] XP_006483273.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Citrus sinensis] XP_006483274.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Citrus sinensis] Length = 751 Score = 120 bits (302), Expect = 7e-29 Identities = 56/92 (60%), Positives = 69/92 (75%) Frame = +2 Query: 2 EAGFLHKEMIEKGHKLTVDSYNAIIKGYIKRKKYMEAAELFREMRSNGLVADRELYNTFM 181 EA FLHKEM++KG LT SYNA+IKG++KRKKY+EA ELF EMR GLVADRE+Y F+ Sbjct: 659 EAWFLHKEMVQKGFNLTTSSYNALIKGFLKRKKYLEARELFEEMRRGGLVADREIYYFFV 718 Query: 182 ELNFHEGNVAMTIELCDETLENCLVDKTNSRN 277 ++NF EGN +T+ELCD +E LV K N Sbjct: 719 DINFEEGNTEITLELCDAAIECYLVGKATDEN 750 >XP_015168807.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Solanum tuberosum] XP_015168808.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Solanum tuberosum] XP_015168809.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Solanum tuberosum] XP_015168810.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Solanum tuberosum] Length = 752 Score = 120 bits (302), Expect = 7e-29 Identities = 53/92 (57%), Positives = 74/92 (80%) Frame = +2 Query: 2 EAGFLHKEMIEKGHKLTVDSYNAIIKGYIKRKKYMEAAELFREMRSNGLVADRELYNTFM 181 EA FLHKEMI+KG T+++Y+A+IKG++KRKKY EA E+F EMR GL+AD+ELY+ F Sbjct: 660 EAWFLHKEMIKKGFTPTLETYHALIKGFLKRKKYSEAKEMFEEMRRYGLLADKELYSIFA 719 Query: 182 ELNFHEGNVAMTIELCDETLENCLVDKTNSRN 277 ++N+ +GN + +ELCDE +E CL DKT++RN Sbjct: 720 DMNYEQGNFDLALELCDEAVEKCLADKTDNRN 751 >XP_019230759.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial isoform X2 [Nicotiana attenuata] Length = 647 Score = 120 bits (301), Expect = 8e-29 Identities = 54/92 (58%), Positives = 73/92 (79%) Frame = +2 Query: 2 EAGFLHKEMIEKGHKLTVDSYNAIIKGYIKRKKYMEAAELFREMRSNGLVADRELYNTFM 181 EA FLHKEMI+KG TVD+Y+A+IKG+++RKKY EA E+F EMR GL+AD+ELY+ F Sbjct: 555 EAWFLHKEMIKKGFTPTVDTYHALIKGFLRRKKYSEAKEMFEEMRREGLLADKELYSIFA 614 Query: 182 ELNFHEGNVAMTIELCDETLENCLVDKTNSRN 277 ++N+ GN + +ELCDE LE C+ DKT++RN Sbjct: 615 DMNYELGNFDLALELCDEALEKCVSDKTDNRN 646 >CBI32045.3 unnamed protein product, partial [Vitis vinifera] Length = 648 Score = 120 bits (301), Expect = 8e-29 Identities = 53/92 (57%), Positives = 71/92 (77%) Frame = +2 Query: 2 EAGFLHKEMIEKGHKLTVDSYNAIIKGYIKRKKYMEAAELFREMRSNGLVADRELYNTFM 181 EA FLH++M+ KG LTV SYNA+IKG+ KRKK++EA ELF +MR GLVADRE+YN F Sbjct: 556 EAWFLHRDMVGKGFNLTVSSYNALIKGFYKRKKFLEARELFEQMRREGLVADREIYNIFA 615 Query: 182 ELNFHEGNVAMTIELCDETLENCLVDKTNSRN 277 ++N+ EG + +T+ELCDE +E CLV ++N Sbjct: 616 DINYDEGKMELTLELCDEAIEKCLVGDIQTKN 647 >XP_002268680.2 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Vitis vinifera] XP_010652656.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Vitis vinifera] XP_010652663.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Vitis vinifera] XP_010652679.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Vitis vinifera] XP_010652686.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Vitis vinifera] XP_010652689.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Vitis vinifera] XP_010652692.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Vitis vinifera] Length = 748 Score = 120 bits (301), Expect = 9e-29 Identities = 53/92 (57%), Positives = 71/92 (77%) Frame = +2 Query: 2 EAGFLHKEMIEKGHKLTVDSYNAIIKGYIKRKKYMEAAELFREMRSNGLVADRELYNTFM 181 EA FLH++M+ KG LTV SYNA+IKG+ KRKK++EA ELF +MR GLVADRE+YN F Sbjct: 656 EAWFLHRDMVGKGFNLTVSSYNALIKGFYKRKKFLEARELFEQMRREGLVADREIYNIFA 715 Query: 182 ELNFHEGNVAMTIELCDETLENCLVDKTNSRN 277 ++N+ EG + +T+ELCDE +E CLV ++N Sbjct: 716 DINYDEGKMELTLELCDEAIEKCLVGDIQTKN 747 >XP_019230747.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial isoform X1 [Nicotiana attenuata] XP_019230748.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial isoform X1 [Nicotiana attenuata] XP_019230749.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial isoform X1 [Nicotiana attenuata] XP_019230750.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial isoform X1 [Nicotiana attenuata] XP_019230751.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial isoform X1 [Nicotiana attenuata] XP_019230752.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial isoform X1 [Nicotiana attenuata] XP_019230754.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial isoform X1 [Nicotiana attenuata] XP_019230755.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial isoform X1 [Nicotiana attenuata] XP_019230756.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial isoform X1 [Nicotiana attenuata] XP_019230757.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial isoform X1 [Nicotiana attenuata] XP_019230758.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial isoform X1 [Nicotiana attenuata] OIT29206.1 pentatricopeptide repeat-containing protein, mitochondrial [Nicotiana attenuata] Length = 752 Score = 120 bits (301), Expect = 9e-29 Identities = 54/92 (58%), Positives = 73/92 (79%) Frame = +2 Query: 2 EAGFLHKEMIEKGHKLTVDSYNAIIKGYIKRKKYMEAAELFREMRSNGLVADRELYNTFM 181 EA FLHKEMI+KG TVD+Y+A+IKG+++RKKY EA E+F EMR GL+AD+ELY+ F Sbjct: 660 EAWFLHKEMIKKGFTPTVDTYHALIKGFLRRKKYSEAKEMFEEMRREGLLADKELYSIFA 719 Query: 182 ELNFHEGNVAMTIELCDETLENCLVDKTNSRN 277 ++N+ GN + +ELCDE LE C+ DKT++RN Sbjct: 720 DMNYELGNFDLALELCDEALEKCVSDKTDNRN 751 >EEF42222.1 pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 604 Score = 120 bits (300), Expect = 1e-28 Identities = 54/92 (58%), Positives = 69/92 (75%) Frame = +2 Query: 2 EAGFLHKEMIEKGHKLTVDSYNAIIKGYIKRKKYMEAAELFREMRSNGLVADRELYNTFM 181 EA FLHKEM+EK LT SYNA+IKG+ KRKK +EA +LF EMR GLVA E+YN F+ Sbjct: 513 EAWFLHKEMVEKRFNLTASSYNALIKGFFKRKKLLEARQLFEEMRREGLVASAEIYNLFV 572 Query: 182 ELNFHEGNVAMTIELCDETLENCLVDKTNSRN 277 ++N+ EGN+ T+ELCDE +E CL+DK + N Sbjct: 573 DMNYEEGNMETTLELCDEAIEKCLLDKARNGN 604 >XP_019069568.1 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial isoform X2 [Solanum lycopersicum] Length = 698 Score = 120 bits (300), Expect = 1e-28 Identities = 53/92 (57%), Positives = 73/92 (79%) Frame = +2 Query: 2 EAGFLHKEMIEKGHKLTVDSYNAIIKGYIKRKKYMEAAELFREMRSNGLVADRELYNTFM 181 EA FLHKEMI+KG T+++Y+A+IKG++KRKKY EA ELF EMR GL+AD+E Y+ F Sbjct: 606 EAWFLHKEMIKKGFTPTLETYHALIKGFLKRKKYSEAKELFEEMRRYGLLADKEFYSIFA 665 Query: 182 ELNFHEGNVAMTIELCDETLENCLVDKTNSRN 277 ++N+ +GN + +ELCDE +E CL DKT++RN Sbjct: 666 DMNYEQGNFDLALELCDEAVEKCLTDKTDNRN 697