BLASTX nr result
ID: Angelica27_contig00028671
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00028671 (292 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017254852.1 PREDICTED: alpha-galactosidase-like [Daucus carot... 98 5e-22 KZM89404.1 hypothetical protein DCAR_023233 [Daucus carota subsp... 92 8e-20 XP_010031355.1 PREDICTED: alpha-galactosidase 1 [Eucalyptus gran... 55 1e-06 >XP_017254852.1 PREDICTED: alpha-galactosidase-like [Daucus carota subsp. sativus] Length = 421 Score = 97.8 bits (242), Expect = 5e-22 Identities = 54/81 (66%), Positives = 57/81 (70%) Frame = +1 Query: 49 MGFYYRISSNLLAKXXXXXXXXXXXXSSHGIEGAAKEIKVERTSDDLRNGFVLDSLQEIR 228 MGFY R S LL S GIE AA+EIKVERT+DD NGFVLD+LQEIR Sbjct: 1 MGFYCRFSCRLLVSLVCFWLFVT---SYSGIE-AAEEIKVERTADDQLNGFVLDNLQEIR 56 Query: 229 TKLVANGIGLTPQMGWNSWNH 291 KLVANGIGLTPQMGWNSWNH Sbjct: 57 MKLVANGIGLTPQMGWNSWNH 77 >KZM89404.1 hypothetical protein DCAR_023233 [Daucus carota subsp. sativus] Length = 399 Score = 91.7 bits (226), Expect = 8e-20 Identities = 45/52 (86%), Positives = 48/52 (92%) Frame = +1 Query: 136 GIEGAAKEIKVERTSDDLRNGFVLDSLQEIRTKLVANGIGLTPQMGWNSWNH 291 GIE AA+EIKVERT+DD NGFVLD+LQEIR KLVANGIGLTPQMGWNSWNH Sbjct: 5 GIE-AAEEIKVERTADDQLNGFVLDNLQEIRMKLVANGIGLTPQMGWNSWNH 55 >XP_010031355.1 PREDICTED: alpha-galactosidase 1 [Eucalyptus grandis] KCW50620.1 hypothetical protein EUGRSUZ_J00326 [Eucalyptus grandis] Length = 421 Score = 54.7 bits (130), Expect = 1e-06 Identities = 27/49 (55%), Positives = 32/49 (65%) Frame = +1 Query: 145 GAAKEIKVERTSDDLRNGFVLDSLQEIRTKLVANGIGLTPQMGWNSWNH 291 GAA + KV DL++ L QE R L+ANG+GLTP MGWNSWNH Sbjct: 31 GAASKAKV-----DLKSSTYLHYKQEYRRNLLANGLGLTPPMGWNSWNH 74