BLASTX nr result
ID: Angelica27_contig00028664
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00028664 (307 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003596892.1 hypothetical protein MTR_2g087370 [Medicago trunc... 57 2e-08 KCW65018.1 hypothetical protein EUGRSUZ_G02553 [Eucalyptus grandis] 57 3e-07 XP_003630943.1 hypothetical protein MTR_8g105280 [Medicago trunc... 52 5e-07 XP_003593481.1 hypothetical protein MTR_2g012640 [Medicago trunc... 51 2e-06 XP_003618545.1 transmembrane protein, putative [Medicago truncat... 51 2e-06 XP_007214742.1 hypothetical protein PRUPE_ppa025162mg [Prunus pe... 52 8e-06 >XP_003596892.1 hypothetical protein MTR_2g087370 [Medicago truncatula] AES67143.1 hypothetical protein MTR_2g087370 [Medicago truncatula] Length = 96 Score = 56.6 bits (135), Expect = 2e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 87 GDAGYRSPYLSHAKRALYHLSYIPI 161 GDAGYRSPYLSHAKRALYHLSYIPI Sbjct: 63 GDAGYRSPYLSHAKRALYHLSYIPI 87 >KCW65018.1 hypothetical protein EUGRSUZ_G02553 [Eucalyptus grandis] Length = 575 Score = 56.6 bits (135), Expect = 3e-07 Identities = 27/41 (65%), Positives = 29/41 (70%) Frame = +3 Query: 39 GVWTVKGESLTLVLKHGDAGYRSPYLSHAKRALYHLSYIPI 161 GVW + GDAGYRSPYLSHAKRALYHLSYIP+ Sbjct: 529 GVWLRGNKKTKKNEISGDAGYRSPYLSHAKRALYHLSYIPL 569 >XP_003630943.1 hypothetical protein MTR_8g105280 [Medicago truncatula] AET05419.1 hypothetical protein MTR_8g105280 [Medicago truncatula] Length = 64 Score = 52.4 bits (124), Expect = 5e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = -2 Query: 159 WGCSSDGRALA*HARGTGIDTPHLH 85 WGCSS GRALA HARGTG DTPHLH Sbjct: 2 WGCSSHGRALALHARGTGFDTPHLH 26 >XP_003593481.1 hypothetical protein MTR_2g012640 [Medicago truncatula] AES63732.1 hypothetical protein MTR_2g012640 [Medicago truncatula] Length = 58 Score = 50.8 bits (120), Expect = 2e-06 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = -2 Query: 159 WGCSSDGRALA*HARGTGIDTPHLH 85 WGCSS+GRALA HARGTG D PHLH Sbjct: 31 WGCSSNGRALALHARGTGFDPPHLH 55 >XP_003618545.1 transmembrane protein, putative [Medicago truncatula] AES74763.1 transmembrane protein, putative [Medicago truncatula] Length = 61 Score = 50.8 bits (120), Expect = 2e-06 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = +3 Query: 75 VLKHGDAGYRSPYLSHAKRALYHLSYIPI 161 + K+GDAG R+P LSHAKRALYHLSYIPI Sbjct: 3 IQKNGDAGDRTPCLSHAKRALYHLSYIPI 31 >XP_007214742.1 hypothetical protein PRUPE_ppa025162mg [Prunus persica] Length = 268 Score = 52.4 bits (124), Expect = 8e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 167 TSNGDVAQMVERSLSMREVRGSIPRISM 84 TS GDVAQMVERSLSMREVRGSIPRIS+ Sbjct: 197 TSKGDVAQMVERSLSMREVRGSIPRISI 224