BLASTX nr result
ID: Angelica27_contig00028611
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00028611 (341 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017237775.1 PREDICTED: protein TPX2-like [Daucus carota subsp... 64 2e-09 >XP_017237775.1 PREDICTED: protein TPX2-like [Daucus carota subsp. sativus] KZN08335.1 hypothetical protein DCAR_000881 [Daucus carota subsp. sativus] Length = 517 Score = 63.5 bits (153), Expect = 2e-09 Identities = 34/50 (68%), Positives = 37/50 (74%) Frame = -1 Query: 182 SGLSSDGLTFYNHMIES*TKMFANARAFVSRVSALMKPTACQMAKQICSG 33 +G GLTFYNHM ES T+ ANAR FVSRVS LMKPTA Q+AKQ SG Sbjct: 145 AGAIPAGLTFYNHMNESKTRRNANARPFVSRVSTLMKPTASQLAKQSRSG 194