BLASTX nr result
ID: Angelica27_contig00028528
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00028528 (368 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016548873.1 PREDICTED: F-box/kelch-repeat protein At3g23880-l... 55 2e-06 >XP_016548873.1 PREDICTED: F-box/kelch-repeat protein At3g23880-like [Capsicum annuum] XP_016548874.1 PREDICTED: F-box/kelch-repeat protein At3g23880-like [Capsicum annuum] Length = 418 Score = 55.1 bits (131), Expect = 2e-06 Identities = 28/62 (45%), Positives = 37/62 (59%) Frame = -1 Query: 188 RRKDT*RNPAEMSNPPPSKKQELIIVPGYISQHVITEILLRLPVKWLLQYKSVCKSWYTL 9 RR+ R P + P + + +V + Q VIT IL+RLPVK+LLQ+K V K WY L Sbjct: 30 RRRSKRRKPRNHTQIPSTSSNDSALVVPTLPQEVITAILVRLPVKYLLQFKCVSKHWYAL 89 Query: 8 IS 3 IS Sbjct: 90 IS 91