BLASTX nr result
ID: Angelica27_contig00028525
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00028525 (339 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017242213.1 PREDICTED: pentatricopeptide repeat-containing pr... 80 2e-15 XP_018834142.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 6e-09 CAN75614.1 hypothetical protein VITISV_022293 [Vitis vinifera] 60 3e-08 XP_010660523.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 3e-08 CBI16890.3 unnamed protein product, partial [Vitis vinifera] 60 3e-08 XP_015880462.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 4e-08 XP_007208255.1 hypothetical protein PRUPE_ppa016546mg [Prunus pe... 59 8e-08 CDP02378.1 unnamed protein product [Coffea canephora] 59 1e-07 XP_008233899.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 5e-07 XP_004288209.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 5e-07 XP_012852219.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 1e-06 GAV85599.1 PPR domain-containing protein/PPR_1 domain-containing... 55 1e-06 XP_006340477.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 1e-06 XP_009603085.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 1e-06 XP_019176394.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 2e-06 KZV24996.1 pentatricopeptide repeat-containing protein [Dorcocer... 54 4e-06 XP_011099085.1 PREDICTED: pentatricopeptide repeat-containing pr... 54 4e-06 XP_010100903.1 hypothetical protein L484_009673 [Morus notabilis... 54 6e-06 XP_009340504.1 PREDICTED: pentatricopeptide repeat-containing pr... 53 8e-06 XP_019237569.1 PREDICTED: pentatricopeptide repeat-containing pr... 53 8e-06 >XP_017242213.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Daucus carota subsp. sativus] XP_017242214.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Daucus carota subsp. sativus] XP_017242215.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Daucus carota subsp. sativus] XP_017242216.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Daucus carota subsp. sativus] XP_017242217.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Daucus carota subsp. sativus] XP_017242218.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Daucus carota subsp. sativus] XP_017242219.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Daucus carota subsp. sativus] XP_017242220.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Daucus carota subsp. sativus] XP_017242222.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Daucus carota subsp. sativus] XP_017242223.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Daucus carota subsp. sativus] XP_017242224.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Daucus carota subsp. sativus] XP_017242225.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Daucus carota subsp. sativus] XP_017242226.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Daucus carota subsp. sativus] XP_017242228.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Daucus carota subsp. sativus] XP_017242229.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Daucus carota subsp. sativus] XP_017242230.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Daucus carota subsp. sativus] Length = 590 Score = 80.5 bits (197), Expect = 2e-15 Identities = 39/57 (68%), Positives = 45/57 (78%) Frame = -2 Query: 173 MGSVARLTGDTQLVKIACAIVLKGHWNNLFNPKIQSFSNSNIINQVLLDVSLYNSNL 3 MGSV RL+ DTQ VKIA AIV++GHW+ LFN KIQSF NSN INQVL SL+N N+ Sbjct: 1 MGSVVRLSSDTQFVKIASAIVVRGHWDTLFNSKIQSFVNSNTINQVLFHTSLHNFNV 57 >XP_018834142.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Juglans regia] Length = 588 Score = 62.0 bits (149), Expect = 6e-09 Identities = 29/54 (53%), Positives = 38/54 (70%) Frame = -2 Query: 173 MGSVARLTGDTQLVKIACAIVLKGHWNNLFNPKIQSFSNSNIINQVLLDVSLYN 12 M ++ LT +TQLV+ CAIV+KG+WNNL PKI S S +QVLL +SLY+ Sbjct: 1 MAAIVCLTNETQLVQAICAIVVKGYWNNLLKPKISSTLTSTTTHQVLLQLSLYS 54 >CAN75614.1 hypothetical protein VITISV_022293 [Vitis vinifera] Length = 590 Score = 60.1 bits (144), Expect = 3e-08 Identities = 28/52 (53%), Positives = 36/52 (69%) Frame = -2 Query: 173 MGSVARLTGDTQLVKIACAIVLKGHWNNLFNPKIQSFSNSNIINQVLLDVSL 18 M S+ G+TQL KI C IV+KGHWN+L P + S S I+NQVLL++SL Sbjct: 1 MASLVFQCGETQLAKIVCGIVVKGHWNSLLKPNVGSNLTSTILNQVLLNLSL 52 >XP_010660523.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Vitis vinifera] XP_010660524.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Vitis vinifera] XP_019080246.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Vitis vinifera] XP_019080247.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Vitis vinifera] XP_019080248.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Vitis vinifera] XP_019080249.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Vitis vinifera] XP_019080250.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Vitis vinifera] XP_019080251.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Vitis vinifera] XP_019080252.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Vitis vinifera] XP_019080253.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Vitis vinifera] XP_019080254.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Vitis vinifera] XP_019080255.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Vitis vinifera] Length = 590 Score = 60.1 bits (144), Expect = 3e-08 Identities = 28/52 (53%), Positives = 36/52 (69%) Frame = -2 Query: 173 MGSVARLTGDTQLVKIACAIVLKGHWNNLFNPKIQSFSNSNIINQVLLDVSL 18 M S+ G+TQL KI C IV+KGHWN+L P + S S I+NQVLL++SL Sbjct: 1 MASLVFQCGETQLAKIVCGIVVKGHWNSLLKPNVGSNLTSTILNQVLLNLSL 52 >CBI16890.3 unnamed protein product, partial [Vitis vinifera] Length = 653 Score = 60.1 bits (144), Expect = 3e-08 Identities = 28/52 (53%), Positives = 36/52 (69%) Frame = -2 Query: 173 MGSVARLTGDTQLVKIACAIVLKGHWNNLFNPKIQSFSNSNIINQVLLDVSL 18 M S+ G+TQL KI C IV+KGHWN+L P + S S I+NQVLL++SL Sbjct: 26 MASLVFQCGETQLAKIVCGIVVKGHWNSLLKPNVGSNLTSTILNQVLLNLSL 77 >XP_015880462.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Ziziphus jujuba] Length = 589 Score = 59.7 bits (143), Expect = 4e-08 Identities = 27/53 (50%), Positives = 34/53 (64%) Frame = -2 Query: 173 MGSVARLTGDTQLVKIACAIVLKGHWNNLFNPKIQSFSNSNIINQVLLDVSLY 15 M + L G+TQ ++ C+IV+KGHWN LFNPK NS I QVLL +S Y Sbjct: 1 MAGLVSLPGETQFIQSVCSIVIKGHWNKLFNPKTGFCFNSTAIQQVLLQLSRY 53 >XP_007208255.1 hypothetical protein PRUPE_ppa016546mg [Prunus persica] ONI02236.1 hypothetical protein PRUPE_6G186200 [Prunus persica] ONI02237.1 hypothetical protein PRUPE_6G186200 [Prunus persica] Length = 589 Score = 58.9 bits (141), Expect = 8e-08 Identities = 27/53 (50%), Positives = 37/53 (69%) Frame = -2 Query: 173 MGSVARLTGDTQLVKIACAIVLKGHWNNLFNPKIQSFSNSNIINQVLLDVSLY 15 M + LTG+TQ + CA+V+KGHWNN+ PKI S +S I+QVLL +SL+ Sbjct: 1 MAVLVSLTGETQFIHSLCAVVVKGHWNNILKPKIGSSLSSANIHQVLLQLSLH 53 >CDP02378.1 unnamed protein product [Coffea canephora] Length = 591 Score = 58.5 bits (140), Expect = 1e-07 Identities = 26/57 (45%), Positives = 39/57 (68%) Frame = -2 Query: 173 MGSVARLTGDTQLVKIACAIVLKGHWNNLFNPKIQSFSNSNIINQVLLDVSLYNSNL 3 M S R++ ++ VK CAIV+KGHW+++ PKI SF +S+ INQ L+ +S Y +L Sbjct: 1 MASSVRVSSESLFVKTVCAIVVKGHWDDILKPKIGSFVSSSTINQALISLSSYGFSL 57 >XP_008233899.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Prunus mume] Length = 589 Score = 56.6 bits (135), Expect = 5e-07 Identities = 26/53 (49%), Positives = 37/53 (69%) Frame = -2 Query: 173 MGSVARLTGDTQLVKIACAIVLKGHWNNLFNPKIQSFSNSNIINQVLLDVSLY 15 M + LTG+TQ ++ CA+V+KG WNN+ PKI S +S I+QVLL +SL+ Sbjct: 1 MAVLVSLTGETQFIQSLCAVVVKGQWNNILKPKIGSSLSSANIHQVLLQLSLH 53 >XP_004288209.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Fragaria vesca subsp. vesca] Length = 589 Score = 56.6 bits (135), Expect = 5e-07 Identities = 28/53 (52%), Positives = 38/53 (71%) Frame = -2 Query: 173 MGSVARLTGDTQLVKIACAIVLKGHWNNLFNPKIQSFSNSNIINQVLLDVSLY 15 M + LT +TQL++ AIVLKGHW++L NPK+ S S+ I+QVLL +SLY Sbjct: 1 MAAPVPLTVETQLIQSLFAIVLKGHWSHLLNPKLGSCLTSSAIHQVLLQLSLY 53 >XP_012852219.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Erythranthe guttata] Length = 586 Score = 55.5 bits (132), Expect = 1e-06 Identities = 24/57 (42%), Positives = 39/57 (68%) Frame = -2 Query: 173 MGSVARLTGDTQLVKIACAIVLKGHWNNLFNPKIQSFSNSNIINQVLLDVSLYNSNL 3 M + +G+ +LVK CA+V+KG+W+ L PKI S S+++NQ LLD+S Y+ ++ Sbjct: 1 MEGLISASGERRLVKAVCAVVIKGYWDKLLKPKIGSLVTSSVMNQSLLDLSPYSVSI 57 >GAV85599.1 PPR domain-containing protein/PPR_1 domain-containing protein/PPR_2 domain-containing protein [Cephalotus follicularis] Length = 588 Score = 55.5 bits (132), Expect = 1e-06 Identities = 26/56 (46%), Positives = 35/56 (62%) Frame = -2 Query: 173 MGSVARLTGDTQLVKIACAIVLKGHWNNLFNPKIQSFSNSNIINQVLLDVSLYNSN 6 M ++ L +T L++ AIVLKGHW NL PK+ S S INQ+LL +SLY + Sbjct: 1 MANLTSLNNETHLIQSIYAIVLKGHWQNLLQPKLSSNLTSKTINQLLLHLSLYTKS 56 >XP_006340477.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Solanum tuberosum] XP_015159112.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Solanum tuberosum] XP_006340476.2 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Solanum tuberosum] XP_015159113.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Solanum tuberosum] XP_015159118.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Solanum tuberosum] Length = 588 Score = 55.5 bits (132), Expect = 1e-06 Identities = 26/57 (45%), Positives = 35/57 (61%) Frame = -2 Query: 173 MGSVARLTGDTQLVKIACAIVLKGHWNNLFNPKIQSFSNSNIINQVLLDVSLYNSNL 3 M ++ R D ++VK A+V KGHW+NL PKI SF S I+Q LL +S Y +L Sbjct: 1 MANLIRANVDNEMVKAVAAVVFKGHWDNLLKPKIGSFVTSTTISQALLHISQYYFSL 57 >XP_009603085.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Nicotiana tomentosiformis] Length = 590 Score = 55.5 bits (132), Expect = 1e-06 Identities = 26/53 (49%), Positives = 35/53 (66%) Frame = -2 Query: 173 MGSVARLTGDTQLVKIACAIVLKGHWNNLFNPKIQSFSNSNIINQVLLDVSLY 15 M S+ R ++++VK A VLKG+W+NL PKI SF S I+Q LLD+S Y Sbjct: 1 MASLVRANVESEMVKAVAAAVLKGNWDNLLKPKIGSFVTSTTISQALLDISQY 53 >XP_019176394.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Ipomoea nil] XP_019176395.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Ipomoea nil] Length = 592 Score = 55.1 bits (131), Expect = 2e-06 Identities = 28/53 (52%), Positives = 32/53 (60%) Frame = -2 Query: 179 IQMGSVARLTGDTQLVKIACAIVLKGHWNNLFNPKIQSFSNSNIINQVLLDVS 21 + M S A ++QLVK C IVLKGHWNNL PKI S IIN LL +S Sbjct: 1 MSMASSAGANTESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLS 53 >KZV24996.1 pentatricopeptide repeat-containing protein [Dorcoceras hygrometricum] Length = 584 Score = 53.9 bits (128), Expect = 4e-06 Identities = 24/53 (45%), Positives = 36/53 (67%) Frame = -2 Query: 173 MGSVARLTGDTQLVKIACAIVLKGHWNNLFNPKIQSFSNSNIINQVLLDVSLY 15 M S+ + ++QLVK CA+V+KGHW+N P+I S S+I+NQ L+ +S Y Sbjct: 1 MASLIYASSESQLVKSVCAVVIKGHWDNHLKPRICSVLTSSILNQALIVLSSY 53 >XP_011099085.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Sesamum indicum] XP_011099086.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Sesamum indicum] Length = 588 Score = 53.9 bits (128), Expect = 4e-06 Identities = 25/57 (43%), Positives = 38/57 (66%) Frame = -2 Query: 173 MGSVARLTGDTQLVKIACAIVLKGHWNNLFNPKIQSFSNSNIINQVLLDVSLYNSNL 3 MGS+ + + QLV+ CAIV+KG+W L PKI S S+++NQ LL++S Y ++ Sbjct: 1 MGSLNFASSERQLVRTVCAIVVKGYWVKLLKPKIGSLVTSSVMNQALLNLSPYEFSI 57 >XP_010100903.1 hypothetical protein L484_009673 [Morus notabilis] EXB85827.1 hypothetical protein L484_009673 [Morus notabilis] Length = 584 Score = 53.5 bits (127), Expect = 6e-06 Identities = 22/47 (46%), Positives = 34/47 (72%) Frame = -2 Query: 155 LTGDTQLVKIACAIVLKGHWNNLFNPKIQSFSNSNIINQVLLDVSLY 15 + G+TQ ++ CA+V+KG W+NLFNPK+ +S I+QVL +SL+ Sbjct: 1 MAGETQFIQSVCAVVIKGQWSNLFNPKVGVCLSSTTIHQVLQQLSLH 47 >XP_009340504.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like [Pyrus x bretschneideri] Length = 585 Score = 53.1 bits (126), Expect = 8e-06 Identities = 25/57 (43%), Positives = 35/57 (61%) Frame = -2 Query: 173 MGSVARLTGDTQLVKIACAIVLKGHWNNLFNPKIQSFSNSNIINQVLLDVSLYNSNL 3 M ++ LTG+TQ + CAIV+KG W+NL P S +S I+QVLL +S + L Sbjct: 1 MAALISLTGETQFIHSVCAIVVKGQWSNLLKPNNDSLLSSATIHQVLLQLSFHGYGL 57 >XP_019237569.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Nicotiana attenuata] OIT22320.1 pentatricopeptide repeat-containing protein [Nicotiana attenuata] Length = 590 Score = 53.1 bits (126), Expect = 8e-06 Identities = 24/44 (54%), Positives = 32/44 (72%) Frame = -2 Query: 146 DTQLVKIACAIVLKGHWNNLFNPKIQSFSNSNIINQVLLDVSLY 15 ++++VK A VLKG+W+NL PKI SF S II+Q LLD+S Y Sbjct: 10 ESEMVKAVAAAVLKGNWDNLLKPKIGSFVTSTIISQALLDISQY 53