BLASTX nr result
ID: Angelica27_contig00028257
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00028257 (262 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017217841.1 PREDICTED: desiccation protectant protein Lea14 h... 80 2e-18 XP_017218183.1 PREDICTED: desiccation protectant protein Lea14 h... 69 1e-12 KZN04525.1 hypothetical protein DCAR_005362 [Daucus carota subsp... 64 7e-11 XP_016746494.1 PREDICTED: desiccation protectant protein Lea14 h... 62 4e-10 XP_016745590.1 PREDICTED: late embryogenesis abundant protein Le... 62 4e-10 XP_012481600.1 PREDICTED: late embryogenesis abundant protein Le... 62 4e-10 KFK42534.1 hypothetical protein AALP_AA1G007000 [Arabis alpina] 62 5e-10 XP_010559103.1 PREDICTED: desiccation protectant protein Lea14 h... 60 2e-09 XP_010474746.1 PREDICTED: probable desiccation-related protein L... 60 2e-09 XP_010457121.1 PREDICTED: probable desiccation-related protein L... 60 2e-09 XP_016193964.1 PREDICTED: desiccation protectant protein Lea14 h... 61 2e-09 XP_015961875.1 PREDICTED: desiccation protectant protein Lea14 h... 61 2e-09 XP_017640396.1 PREDICTED: desiccation protectant protein Lea14 h... 59 4e-09 XP_017236971.1 PREDICTED: desiccation protectant protein Lea14 h... 59 4e-09 EYU19195.1 hypothetical protein MIMGU_mgv1a015256mg [Erythranthe... 59 5e-09 NP_171654.1 Late embryogenesis abundant protein [Arabidopsis tha... 59 5e-09 XP_002889364.1 hypothetical protein ARALYDRAFT_333508 [Arabidops... 59 5e-09 XP_019415638.1 PREDICTED: desiccation protectant protein Lea14 h... 59 6e-09 KVH97245.1 Immunoglobulin-like fold [Cynara cardunculus var. sco... 59 7e-09 XP_010544773.1 PREDICTED: desiccation protectant protein Lea14 h... 59 7e-09 >XP_017217841.1 PREDICTED: desiccation protectant protein Lea14 homolog [Daucus carota subsp. sativus] KZM88144.1 hypothetical protein DCAR_025219 [Daucus carota subsp. sativus] Length = 161 Score = 79.7 bits (195), Expect(2) = 2e-18 Identities = 37/48 (77%), Positives = 39/48 (81%) Frame = -2 Query: 171 ADWDIDYDLGITFVTNVPATGDITVPISNKGQMKLPTFKDLYTLVNLT 28 ADWDIDYDL I V NVPA GD+T+PISNKGQMKLPT KDL L NLT Sbjct: 107 ADWDIDYDLQINVVGNVPAMGDVTIPISNKGQMKLPTLKDLSALANLT 154 Score = 39.7 bits (91), Expect(2) = 2e-18 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -1 Query: 262 PLKVNHTTELELELKAWFTWLVTLARD 182 PLK N TTELE E+K FT LV+LARD Sbjct: 78 PLKANTTTELEFEMKVSFTMLVSLARD 104 >XP_017218183.1 PREDICTED: desiccation protectant protein Lea14 homolog [Daucus carota subsp. sativus] KZM88143.1 hypothetical protein DCAR_025218 [Daucus carota subsp. sativus] Length = 153 Score = 68.6 bits (166), Expect = 1e-12 Identities = 28/43 (65%), Positives = 38/43 (88%) Frame = -2 Query: 171 ADWDIDYDLGITFVTNVPATGDITVPISNKGQMKLPTFKDLYT 43 ADWDIDY+LGI FV ++P G+IT+P+S+KG++KLPTF DL+T Sbjct: 110 ADWDIDYELGIDFVFDLPVFGNITIPVSSKGEIKLPTFSDLWT 152 >KZN04525.1 hypothetical protein DCAR_005362 [Daucus carota subsp. sativus] Length = 153 Score = 63.9 bits (154), Expect = 7e-11 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = -2 Query: 171 ADWDIDYDLGITFVTNVPATGDITVPISNKGQMKLPTFKDLYT 43 ADWDIDYDLGI V ++P G++++P+S KG++KLPTF L+T Sbjct: 110 ADWDIDYDLGINLVIDLPVLGNVSIPVSGKGEIKLPTFSGLWT 152 >XP_016746494.1 PREDICTED: desiccation protectant protein Lea14 homolog [Gossypium hirsutum] Length = 152 Score = 62.0 bits (149), Expect = 4e-10 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = -2 Query: 171 ADWDIDYDLGITFVTNVPATGDITVPISNKGQMKLPTFKDLY 46 ADWDIDY+L + ++P GD+T+P+S KG++KLPTFKDL+ Sbjct: 110 ADWDIDYELEVGLTVDLPLFGDLTIPLSQKGEIKLPTFKDLF 151 >XP_016745590.1 PREDICTED: late embryogenesis abundant protein Lea14-A [Gossypium hirsutum] Length = 152 Score = 62.0 bits (149), Expect = 4e-10 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = -2 Query: 171 ADWDIDYDLGITFVTNVPATGDITVPISNKGQMKLPTFKDLY 46 ADWDIDY+L + ++P GD+T+P+S KG++KLPTFKDL+ Sbjct: 110 ADWDIDYELEVGLTVDLPLFGDLTIPLSQKGEIKLPTFKDLF 151 >XP_012481600.1 PREDICTED: late embryogenesis abundant protein Lea14-A [Gossypium raimondii] KJB09702.1 hypothetical protein B456_001G157400 [Gossypium raimondii] Length = 152 Score = 62.0 bits (149), Expect = 4e-10 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = -2 Query: 171 ADWDIDYDLGITFVTNVPATGDITVPISNKGQMKLPTFKDLY 46 ADWDIDY+L + ++P GD+T+P+S KG++KLPTFKDL+ Sbjct: 110 ADWDIDYELEVGLTVDLPLFGDLTIPLSQKGEIKLPTFKDLF 151 >KFK42534.1 hypothetical protein AALP_AA1G007000 [Arabis alpina] Length = 152 Score = 61.6 bits (148), Expect = 5e-10 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = -2 Query: 171 ADWDIDYDLGITFVTNVPATGDITVPISNKGQMKLPTFKDLY 46 ADWDIDY+L I ++P GDIT+PIS+KG++KLPTF D++ Sbjct: 111 ADWDIDYELKIGLTIDLPIVGDITIPISSKGEIKLPTFTDIF 152 >XP_010559103.1 PREDICTED: desiccation protectant protein Lea14 homolog [Tarenaya hassleriana] Length = 162 Score = 60.5 bits (145), Expect = 2e-09 Identities = 24/42 (57%), Positives = 32/42 (76%) Frame = -2 Query: 171 ADWDIDYDLGITFVTNVPATGDITVPISNKGQMKLPTFKDLY 46 ADWDIDY L + ++P GDIT+P+S KG++KLPT KDL+ Sbjct: 121 ADWDIDYQLDLGLTIDLPVVGDITIPLSTKGEIKLPTLKDLF 162 >XP_010474746.1 PREDICTED: probable desiccation-related protein LEA14 [Camelina sativa] Length = 151 Score = 60.1 bits (144), Expect = 2e-09 Identities = 23/41 (56%), Positives = 33/41 (80%) Frame = -2 Query: 168 DWDIDYDLGITFVTNVPATGDITVPISNKGQMKLPTFKDLY 46 DWDIDY+L I + ++P G+ T+PIS+KG++KLPTFKD + Sbjct: 111 DWDIDYELQIGLIIDLPVVGEFTIPISSKGEIKLPTFKDFF 151 >XP_010457121.1 PREDICTED: probable desiccation-related protein LEA14 [Camelina sativa] Length = 151 Score = 60.1 bits (144), Expect = 2e-09 Identities = 23/41 (56%), Positives = 33/41 (80%) Frame = -2 Query: 168 DWDIDYDLGITFVTNVPATGDITVPISNKGQMKLPTFKDLY 46 DWDIDY+L I + ++P G+ T+PIS+KG++KLPTFKD + Sbjct: 111 DWDIDYELQIGLIIDLPVVGEFTIPISSKGEIKLPTFKDFF 151 >XP_016193964.1 PREDICTED: desiccation protectant protein Lea14 homolog [Arachis ipaensis] Length = 194 Score = 60.8 bits (146), Expect = 2e-09 Identities = 23/42 (54%), Positives = 33/42 (78%) Frame = -2 Query: 168 DWDIDYDLGITFVTNVPATGDITVPISNKGQMKLPTFKDLYT 43 DWDIDY L + V ++P G+IT+P+S KG++KLPT KD++T Sbjct: 138 DWDIDYQLDLGLVIDIPCVGNITIPVSQKGEIKLPTLKDMFT 179 >XP_015961875.1 PREDICTED: desiccation protectant protein Lea14 homolog [Arachis duranensis] Length = 194 Score = 60.8 bits (146), Expect = 2e-09 Identities = 23/42 (54%), Positives = 33/42 (78%) Frame = -2 Query: 168 DWDIDYDLGITFVTNVPATGDITVPISNKGQMKLPTFKDLYT 43 DWDIDY L + V ++P G+IT+P+S KG++KLPT KD++T Sbjct: 138 DWDIDYQLDLGLVIDIPCVGNITIPVSQKGEIKLPTLKDMFT 179 >XP_017640396.1 PREDICTED: desiccation protectant protein Lea14 homolog [Gossypium arboreum] KHG24148.1 Late embryogenesis abundant Lea[2]4-A [Gossypium arboreum] Length = 151 Score = 59.3 bits (142), Expect = 4e-09 Identities = 22/42 (52%), Positives = 33/42 (78%) Frame = -2 Query: 171 ADWDIDYDLGITFVTNVPATGDITVPISNKGQMKLPTFKDLY 46 ADWDIDY+L + ++P GD+T+P+S KG++KLPTF+D + Sbjct: 110 ADWDIDYELEVGLTVDLPLFGDLTIPLSQKGEIKLPTFRDFF 151 >XP_017236971.1 PREDICTED: desiccation protectant protein Lea14 homolog [Daucus carota subsp. sativus] KZN06113.1 hypothetical protein DCAR_006950 [Daucus carota subsp. sativus] Length = 153 Score = 59.3 bits (142), Expect = 4e-09 Identities = 23/43 (53%), Positives = 35/43 (81%) Frame = -2 Query: 171 ADWDIDYDLGITFVTNVPATGDITVPISNKGQMKLPTFKDLYT 43 ADWDIDYDL I + ++P G+I++PI++KG++KLPT DL++ Sbjct: 110 ADWDIDYDLAIVLIVDLPIFGNISIPINSKGEIKLPTVSDLWS 152 >EYU19195.1 hypothetical protein MIMGU_mgv1a015256mg [Erythranthe guttata] Length = 163 Score = 59.3 bits (142), Expect = 5e-09 Identities = 23/44 (52%), Positives = 33/44 (75%) Frame = -2 Query: 177 ASADWDIDYDLGITFVTNVPATGDITVPISNKGQMKLPTFKDLY 46 A+ADWDIDY L + + + P GD+T+P+S +G +KLPTF DL+ Sbjct: 107 AAADWDIDYSLELKMIADFPVIGDVTIPVSYQGVLKLPTFADLF 150 >NP_171654.1 Late embryogenesis abundant protein [Arabidopsis thaliana] O03983.1 RecName: Full=Probable desiccation-related protein LEA14 1XO8_A Chain A, Solution Structure Of At1g01470 From Arabidopsis Thaliana AAF81307.1 Contains similarity to a late embryogenesis abundant protein LEA14-A from Gossypium hirsutum gi|1170745. ESTs gb|T88650, gb|AI994095, gb|Z37258, gb|R30106, gb|H76171 come from this gene [Arabidopsis thaliana] CAA71174.1 putative desication related protein LEA14 [Arabidopsis thaliana] CAA73311.1 LEA protein [Arabidopsis thaliana] AAL75906.1 At1g01470/F22L4_2 [Arabidopsis thaliana] AAT71983.1 At1g01470 [Arabidopsis thaliana] AEE27291.1 Late embryogenesis abundant protein [Arabidopsis thaliana] OAP12008.1 LSR3 [Arabidopsis thaliana] Length = 151 Score = 58.9 bits (141), Expect = 5e-09 Identities = 23/41 (56%), Positives = 32/41 (78%) Frame = -2 Query: 168 DWDIDYDLGITFVTNVPATGDITVPISNKGQMKLPTFKDLY 46 DWDIDY+L I ++P G+ T+PIS+KG++KLPTFKD + Sbjct: 111 DWDIDYELQIGLTIDLPVVGEFTIPISSKGEIKLPTFKDFF 151 >XP_002889364.1 hypothetical protein ARALYDRAFT_333508 [Arabidopsis lyrata subsp. lyrata] EFH65623.1 hypothetical protein ARALYDRAFT_333508 [Arabidopsis lyrata subsp. lyrata] Length = 151 Score = 58.9 bits (141), Expect = 5e-09 Identities = 23/41 (56%), Positives = 32/41 (78%) Frame = -2 Query: 168 DWDIDYDLGITFVTNVPATGDITVPISNKGQMKLPTFKDLY 46 DWDIDY+L I ++P G+ T+PIS+KG++KLPTFKD + Sbjct: 111 DWDIDYELQIGLTIDLPVVGEFTIPISSKGEIKLPTFKDFF 151 >XP_019415638.1 PREDICTED: desiccation protectant protein Lea14 homolog isoform X2 [Lupinus angustifolius] OIV98303.1 hypothetical protein TanjilG_16630 [Lupinus angustifolius] Length = 152 Score = 58.9 bits (141), Expect = 6e-09 Identities = 22/42 (52%), Positives = 32/42 (76%) Frame = -2 Query: 171 ADWDIDYDLGITFVTNVPATGDITVPISNKGQMKLPTFKDLY 46 ADWDIDY L I+ + ++P G+ T+P+S KG+ KLPTF D++ Sbjct: 110 ADWDIDYQLDISLIIDLPVIGNFTIPLSQKGEFKLPTFSDIF 151 >KVH97245.1 Immunoglobulin-like fold [Cynara cardunculus var. scolymus] Length = 162 Score = 58.9 bits (141), Expect = 7e-09 Identities = 21/42 (50%), Positives = 33/42 (78%) Frame = -2 Query: 171 ADWDIDYDLGITFVTNVPATGDITVPISNKGQMKLPTFKDLY 46 ADWDIDY++ I + ++P GDI++P++NKG++KLPT L+ Sbjct: 110 ADWDIDYEVNIVLIVDLPVLGDISIPVNNKGEIKLPTLSSLF 151 >XP_010544773.1 PREDICTED: desiccation protectant protein Lea14 homolog [Tarenaya hassleriana] Length = 163 Score = 58.9 bits (141), Expect = 7e-09 Identities = 24/42 (57%), Positives = 32/42 (76%) Frame = -2 Query: 171 ADWDIDYDLGITFVTNVPATGDITVPISNKGQMKLPTFKDLY 46 ADWDIDY L I ++P G+IT+P+S KG++KLPT KDL+ Sbjct: 122 ADWDIDYQLDIGLTIDLPVIGNITIPLSTKGEIKLPTLKDLF 163