BLASTX nr result
ID: Angelica27_contig00027470
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00027470 (246 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006391200.1 hypothetical protein EUTSA_v10019008mg [Eutrema s... 52 4e-06 XP_020162696.1 protein STAR1-like [Aegilops tauschii subsp. taus... 52 8e-06 EMT32912.1 ABC transporter I family member 17 [Aegilops tauschii] 52 9e-06 >XP_006391200.1 hypothetical protein EUTSA_v10019008mg [Eutrema salsugineum] ESQ28486.1 hypothetical protein EUTSA_v10019008mg [Eutrema salsugineum] Length = 265 Score = 52.4 bits (124), Expect = 4e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -2 Query: 245 VCLVVDGEIVEVLPANDLSLSSHPTAKKFLELST 144 VCLVVDGEIVEVL NDLS ++HP A++FL+LS+ Sbjct: 232 VCLVVDGEIVEVLKPNDLSQATHPMARRFLQLSS 265 >XP_020162696.1 protein STAR1-like [Aegilops tauschii subsp. tauschii] Length = 286 Score = 51.6 bits (122), Expect = 8e-06 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = -2 Query: 245 VCLVVDGEIVEVLPANDLSLSSHPTAKKFLELS 147 VCLVVDGE+VEVL A+DL+ + HP A++FLELS Sbjct: 254 VCLVVDGEVVEVLAASDLARAKHPVARRFLELS 286 >EMT32912.1 ABC transporter I family member 17 [Aegilops tauschii] Length = 323 Score = 51.6 bits (122), Expect = 9e-06 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = -2 Query: 245 VCLVVDGEIVEVLPANDLSLSSHPTAKKFLELS 147 VCLVVDGE+VEVL A+DL+ + HP A++FLELS Sbjct: 291 VCLVVDGEVVEVLAASDLARAKHPVARRFLELS 323