BLASTX nr result
ID: Angelica27_contig00027439
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00027439 (428 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017228174.1 PREDICTED: two-component response regulator ORR9-... 198 3e-62 XP_017234470.1 PREDICTED: two-component response regulator ORR10... 183 3e-56 OMP07475.1 hypothetical protein COLO4_07312 [Corchorus olitorius] 150 9e-44 OMO99053.1 hypothetical protein CCACVL1_03950 [Corchorus capsula... 150 3e-43 XP_007011051.1 PREDICTED: two-component response regulator ORR9 ... 147 4e-42 XP_007220067.1 hypothetical protein PRUPE_ppa025335mg [Prunus pe... 146 7e-42 KDP40526.1 hypothetical protein JCGZ_24525 [Jatropha curcas] 145 1e-41 XP_017618701.1 PREDICTED: two-component response regulator ORR10... 144 2e-41 XP_008245632.1 PREDICTED: two-component response regulator ORR9-... 144 3e-41 XP_008231573.1 PREDICTED: two-component response regulator ORR9-... 144 5e-41 XP_016747756.1 PREDICTED: two-component response regulator ORR10... 142 1e-40 XP_010067733.1 PREDICTED: two-component response regulator ARR9 ... 142 1e-40 XP_002513063.1 PREDICTED: two-component response regulator ARR9 ... 142 2e-40 XP_016723620.1 PREDICTED: two-component response regulator ORR10... 141 3e-40 XP_012461152.1 PREDICTED: two-component response regulator ARR8 ... 141 3e-40 XP_004511028.1 PREDICTED: two-component response regulator ARR9-... 142 3e-40 XP_016724385.1 PREDICTED: two-component response regulator ARR8-... 142 3e-40 XP_012460026.1 PREDICTED: two-component response regulator ARR8-... 142 3e-40 XP_016728049.1 PREDICTED: two-component response regulator ARR8-... 141 5e-40 KDO49056.1 hypothetical protein CISIN_1g046192mg [Citrus sinensis] 141 7e-40 >XP_017228174.1 PREDICTED: two-component response regulator ORR9-like [Daucus carota subsp. sativus] KZN10593.1 hypothetical protein DCAR_003249 [Daucus carota subsp. sativus] Length = 191 Score = 198 bits (503), Expect = 3e-62 Identities = 96/108 (88%), Positives = 103/108 (95%) Frame = +2 Query: 2 PGMTGYDLLRKIKESTSLKDIPVVIMSSENEPARINRCLEEGAEEFFLKPVQLSDVNKLK 181 PGMTGYDLLRKIKESTSLKDIPVVIMSSENEP+RINRCLEEGAEEFFLKPVQLSDVNKLK Sbjct: 84 PGMTGYDLLRKIKESTSLKDIPVVIMSSENEPSRINRCLEEGAEEFFLKPVQLSDVNKLK 143 Query: 182 PHLMRKKIEEVQLTDHKRKSDEECVSPDRRRTRYDEPELLSEEEQKLS 325 PHL+RKK EEV L DHKRKSDE CVSPDRRRT+YDEPELL+++EQ+ S Sbjct: 144 PHLLRKKTEEVHLADHKRKSDEVCVSPDRRRTKYDEPELLAKDEQQTS 191 >XP_017234470.1 PREDICTED: two-component response regulator ORR10-like [Daucus carota subsp. sativus] KZN04657.1 hypothetical protein DCAR_005494 [Daucus carota subsp. sativus] Length = 207 Score = 183 bits (465), Expect = 3e-56 Identities = 95/120 (79%), Positives = 106/120 (88%) Frame = +2 Query: 2 PGMTGYDLLRKIKESTSLKDIPVVIMSSENEPARINRCLEEGAEEFFLKPVQLSDVNKLK 181 PGMTGYDLLRKIKEST LKDIPVVIMSSENEP+RINRCLE+GAEEFFLKPVQLSDVNKLK Sbjct: 85 PGMTGYDLLRKIKESTLLKDIPVVIMSSENEPSRINRCLEQGAEEFFLKPVQLSDVNKLK 144 Query: 182 PHLMRKKIEEVQLTDHKRKSDEECVSPDRRRTRYDEPELLSEEEQKLSR*KYFGFFTFPI 361 PHL+R KIE+VQL+DHKRKSDE VS RRT+Y+ PELLS++EQ++S K GFFT I Sbjct: 145 PHLLRNKIEQVQLSDHKRKSDEVRVSL-HRRTKYEAPELLSKDEQQISGYKDRGFFTSSI 203 >OMP07475.1 hypothetical protein COLO4_07312 [Corchorus olitorius] Length = 169 Score = 150 bits (379), Expect = 9e-44 Identities = 75/100 (75%), Positives = 86/100 (86%) Frame = +2 Query: 2 PGMTGYDLLRKIKESTSLKDIPVVIMSSENEPARINRCLEEGAEEFFLKPVQLSDVNKLK 181 PGMTGYDLL+KIK S+S KDIPVVIMSSEN P+RINRCLE+GAEEFFLKPVQLSDVNKLK Sbjct: 70 PGMTGYDLLKKIKGSSSFKDIPVVIMSSENIPSRINRCLEDGAEEFFLKPVQLSDVNKLK 129 Query: 182 PHLMRKKIEEVQLTDHKRKSDEECVSPDRRRTRYDEPELL 301 PHLMR + +E+Q +KRK EE SPDR RTRY+E E++ Sbjct: 130 PHLMRGRSKEIQPNMNKRKGMEEISSPDRTRTRYNELEVV 169 >OMO99053.1 hypothetical protein CCACVL1_03950 [Corchorus capsularis] Length = 193 Score = 150 bits (378), Expect = 3e-43 Identities = 75/100 (75%), Positives = 86/100 (86%) Frame = +2 Query: 2 PGMTGYDLLRKIKESTSLKDIPVVIMSSENEPARINRCLEEGAEEFFLKPVQLSDVNKLK 181 PGMTGYDLL+KIK S+S KDIPVVIMSSEN P+RINRCLE+GAEEFFLKPVQLSDVNKLK Sbjct: 94 PGMTGYDLLKKIKGSSSFKDIPVVIMSSENIPSRINRCLEDGAEEFFLKPVQLSDVNKLK 153 Query: 182 PHLMRKKIEEVQLTDHKRKSDEECVSPDRRRTRYDEPELL 301 PHLMR + +E+Q +KRK EE SPDR RTRY+E E++ Sbjct: 154 PHLMRGRSKEIQPNMNKRKGMEEINSPDRTRTRYNELEVV 193 >XP_007011051.1 PREDICTED: two-component response regulator ORR9 [Theobroma cacao] EOY19861.1 Two-component response regulator ARR8 [Theobroma cacao] Length = 188 Score = 147 bits (370), Expect = 4e-42 Identities = 72/100 (72%), Positives = 86/100 (86%) Frame = +2 Query: 2 PGMTGYDLLRKIKESTSLKDIPVVIMSSENEPARINRCLEEGAEEFFLKPVQLSDVNKLK 181 PGMTGYDLLR+IK S+S KDIPVVIMSSEN P+RINRCLE+GAEEFFLKPVQLSDVNKL+ Sbjct: 89 PGMTGYDLLRRIKGSSSFKDIPVVIMSSENIPSRINRCLEDGAEEFFLKPVQLSDVNKLR 148 Query: 182 PHLMRKKIEEVQLTDHKRKSDEECVSPDRRRTRYDEPELL 301 PHLM+ + +E+Q KRK EE ++PDR RTRY+E E++ Sbjct: 149 PHLMKGRSKEMQQNISKRKGMEEILTPDRTRTRYNELEVV 188 >XP_007220067.1 hypothetical protein PRUPE_ppa025335mg [Prunus persica] ONI20811.1 hypothetical protein PRUPE_2G034700 [Prunus persica] Length = 185 Score = 146 bits (368), Expect = 7e-42 Identities = 72/101 (71%), Positives = 86/101 (85%) Frame = +2 Query: 2 PGMTGYDLLRKIKESTSLKDIPVVIMSSENEPARINRCLEEGAEEFFLKPVQLSDVNKLK 181 PGMTGYDLLRKIKES LKDIPVVIMSSENEP+RINRCLEEGAEEFFLKPVQLSDVNKLK Sbjct: 85 PGMTGYDLLRKIKESHVLKDIPVVIMSSENEPSRINRCLEEGAEEFFLKPVQLSDVNKLK 144 Query: 182 PHLMRKKIEEVQLTDHKRKSDEECVSPDRRRTRYDEPELLS 304 PH+++ + E Q ++KRK E+ +P+R RT+Y++ E+ S Sbjct: 145 PHMLKGRAMEDQSNNNKRKVMEQTQTPERTRTKYNDLEVTS 185 >KDP40526.1 hypothetical protein JCGZ_24525 [Jatropha curcas] Length = 185 Score = 145 bits (366), Expect = 1e-41 Identities = 75/100 (75%), Positives = 85/100 (85%) Frame = +2 Query: 2 PGMTGYDLLRKIKESTSLKDIPVVIMSSENEPARINRCLEEGAEEFFLKPVQLSDVNKLK 181 PGMTGYDLLRKIKES SLKDIPVVIMSSEN P+RINRCLEEGAEEFFLKPVQLSDVNKLK Sbjct: 85 PGMTGYDLLRKIKESKSLKDIPVVIMSSENVPSRINRCLEEGAEEFFLKPVQLSDVNKLK 144 Query: 182 PHLMRKKIEEVQLTDHKRKSDEECVSPDRRRTRYDEPELL 301 PHLM+ K +E + +KRK +E SP+R RTRY+ E++ Sbjct: 145 PHLMKGKAKEDE-PSNKRKGMDEIHSPERTRTRYEGLEVV 183 >XP_017618701.1 PREDICTED: two-component response regulator ORR10 [Gossypium arboreum] Length = 167 Score = 144 bits (363), Expect = 2e-41 Identities = 72/99 (72%), Positives = 85/99 (85%) Frame = +2 Query: 2 PGMTGYDLLRKIKESTSLKDIPVVIMSSENEPARINRCLEEGAEEFFLKPVQLSDVNKLK 181 PGMTGYDLLRKIKES+S KDIPVVIMSS+N P+RINRCLE+GAEEFFLKPVQLSDVNKL+ Sbjct: 71 PGMTGYDLLRKIKESSSFKDIPVVIMSSDNIPSRINRCLEDGAEEFFLKPVQLSDVNKLR 130 Query: 182 PHLMRKKIEEVQLTDHKRKSDEECVSPDRRRTRYDEPEL 298 PHLM+++ Q +KRK+ +E VSPDR R RY+E E+ Sbjct: 131 PHLMKRR---TQTNVNKRKAMDEIVSPDRTRARYNELEV 166 >XP_008245632.1 PREDICTED: two-component response regulator ORR9-like [Prunus mume] Length = 185 Score = 144 bits (364), Expect = 3e-41 Identities = 72/101 (71%), Positives = 85/101 (84%) Frame = +2 Query: 2 PGMTGYDLLRKIKESTSLKDIPVVIMSSENEPARINRCLEEGAEEFFLKPVQLSDVNKLK 181 PGMTGYDLLRKIKES LKDIPVVIMSSENEP+RINRCLEEGAEEFFLKPVQLSDVNKL+ Sbjct: 85 PGMTGYDLLRKIKESHVLKDIPVVIMSSENEPSRINRCLEEGAEEFFLKPVQLSDVNKLR 144 Query: 182 PHLMRKKIEEVQLTDHKRKSDEECVSPDRRRTRYDEPELLS 304 PH+++ K E Q +KRK E+ +P+R RT+Y++ E+ S Sbjct: 145 PHMLKGKAMEDQSNINKRKVMEQTQTPERTRTKYNDLEVTS 185 >XP_008231573.1 PREDICTED: two-component response regulator ORR9-like [Prunus mume] Length = 185 Score = 144 bits (362), Expect = 5e-41 Identities = 72/101 (71%), Positives = 84/101 (83%) Frame = +2 Query: 2 PGMTGYDLLRKIKESTSLKDIPVVIMSSENEPARINRCLEEGAEEFFLKPVQLSDVNKLK 181 PGMTGYDLLRKIKES LKDIPVVIMSSENEP+RINRCLEEGAEEFFLKPVQLSDVNKLK Sbjct: 85 PGMTGYDLLRKIKESHVLKDIPVVIMSSENEPSRINRCLEEGAEEFFLKPVQLSDVNKLK 144 Query: 182 PHLMRKKIEEVQLTDHKRKSDEECVSPDRRRTRYDEPELLS 304 PH+++ + E Q +KRK E+ +P+R RT Y++ E+ S Sbjct: 145 PHMLKGRAMEDQSNINKRKVMEQTQTPERTRTNYNDLEVTS 185 >XP_016747756.1 PREDICTED: two-component response regulator ORR10-like [Gossypium hirsutum] Length = 167 Score = 142 bits (358), Expect = 1e-40 Identities = 71/99 (71%), Positives = 84/99 (84%) Frame = +2 Query: 2 PGMTGYDLLRKIKESTSLKDIPVVIMSSENEPARINRCLEEGAEEFFLKPVQLSDVNKLK 181 PGMTGYDLLRKIKES+S KDIPVV MSS+N P+RINRCLE+GAEEFFLKPVQLSDVNKL+ Sbjct: 71 PGMTGYDLLRKIKESSSFKDIPVVTMSSDNIPSRINRCLEDGAEEFFLKPVQLSDVNKLR 130 Query: 182 PHLMRKKIEEVQLTDHKRKSDEECVSPDRRRTRYDEPEL 298 PHLM+++ Q +KRK+ +E VSPDR R RY+E E+ Sbjct: 131 PHLMKRR---TQTNVNKRKAMDEIVSPDRTRARYNELEV 166 >XP_010067733.1 PREDICTED: two-component response regulator ARR9 [Eucalyptus grandis] KCW65920.1 hypothetical protein EUGRSUZ_G03236 [Eucalyptus grandis] Length = 183 Score = 142 bits (359), Expect = 1e-40 Identities = 69/100 (69%), Positives = 82/100 (82%) Frame = +2 Query: 2 PGMTGYDLLRKIKESTSLKDIPVVIMSSENEPARINRCLEEGAEEFFLKPVQLSDVNKLK 181 P MTGYDLLRKIKES S KD+PVVIMSSEN P+RI++CLE+GAEEFFLKPVQL+DVNKLK Sbjct: 84 PEMTGYDLLRKIKESNSYKDVPVVIMSSENVPSRISQCLEDGAEEFFLKPVQLADVNKLK 143 Query: 182 PHLMRKKIEEVQLTDHKRKSDEECVSPDRRRTRYDEPELL 301 PHL+R + +E RK EE +SP+R RTRYD PE++ Sbjct: 144 PHLLRGRSKEHHPNSENRKDREEILSPERTRTRYDVPEVI 183 >XP_002513063.1 PREDICTED: two-component response regulator ARR9 [Ricinus communis] EEF49566.1 Two-component response regulator ARR8, putative [Ricinus communis] Length = 197 Score = 142 bits (359), Expect = 2e-40 Identities = 73/94 (77%), Positives = 80/94 (85%) Frame = +2 Query: 2 PGMTGYDLLRKIKESTSLKDIPVVIMSSENEPARINRCLEEGAEEFFLKPVQLSDVNKLK 181 PGMTGYDLLRKIKES S KDIPVVIMSSEN P+RINRCLEEGAEEFFLKPVQLSDVNKLK Sbjct: 93 PGMTGYDLLRKIKESKSFKDIPVVIMSSENVPSRINRCLEEGAEEFFLKPVQLSDVNKLK 152 Query: 182 PHLMRKKIEEVQLTDHKRKSDEECVSPDRRRTRY 283 PH+M+ K E + ++KRK EE SP+R RTRY Sbjct: 153 PHMMKGKTRENE-PNNKRKGMEEIHSPERTRTRY 185 >XP_016723620.1 PREDICTED: two-component response regulator ORR10-like [Gossypium hirsutum] Length = 166 Score = 141 bits (356), Expect = 3e-40 Identities = 72/99 (72%), Positives = 83/99 (83%) Frame = +2 Query: 2 PGMTGYDLLRKIKESTSLKDIPVVIMSSENEPARINRCLEEGAEEFFLKPVQLSDVNKLK 181 PGMTGYDLLRKIKES+S KDIPVVIMSS+N P+RINRCLE GAEEFFLKPVQLSDVNKL+ Sbjct: 71 PGMTGYDLLRKIKESSSFKDIPVVIMSSDNIPSRINRCLEGGAEEFFLKPVQLSDVNKLR 130 Query: 182 PHLMRKKIEEVQLTDHKRKSDEECVSPDRRRTRYDEPEL 298 PHLM++ Q +KRK+ +E VSPDR R RY+E E+ Sbjct: 131 PHLMKR----TQTNVNKRKAMDEIVSPDRTRARYNELEV 165 >XP_012461152.1 PREDICTED: two-component response regulator ARR8 [Gossypium raimondii] KJB78543.1 hypothetical protein B456_013G004700 [Gossypium raimondii] Length = 166 Score = 141 bits (356), Expect = 3e-40 Identities = 72/99 (72%), Positives = 83/99 (83%) Frame = +2 Query: 2 PGMTGYDLLRKIKESTSLKDIPVVIMSSENEPARINRCLEEGAEEFFLKPVQLSDVNKLK 181 PGMTGYDLLRKIKES+S KDIPVVIMSS+N P+RINRCLE GAEEFFLKPVQLSDVNKL+ Sbjct: 71 PGMTGYDLLRKIKESSSFKDIPVVIMSSDNIPSRINRCLEGGAEEFFLKPVQLSDVNKLR 130 Query: 182 PHLMRKKIEEVQLTDHKRKSDEECVSPDRRRTRYDEPEL 298 PHLM++ Q +KRK+ +E VSPDR R RY+E E+ Sbjct: 131 PHLMKR----TQTNVNKRKAMDEIVSPDRTRARYNELEV 165 >XP_004511028.1 PREDICTED: two-component response regulator ARR9-like [Cicer arietinum] Length = 179 Score = 142 bits (357), Expect = 3e-40 Identities = 72/96 (75%), Positives = 82/96 (85%), Gaps = 2/96 (2%) Frame = +2 Query: 2 PGMTGYDLLRKIKESTSLKDIPVVIMSSENEPARINRCLEEGAEEFFLKPVQLSDVNKLK 181 PGMTGYDLLRKIKES S KDIPVVIMSSEN P+RINRCLEEGAEEFFLKPVQ SDVNKLK Sbjct: 82 PGMTGYDLLRKIKESKSFKDIPVVIMSSENVPSRINRCLEEGAEEFFLKPVQQSDVNKLK 141 Query: 182 PHLMRKKI--EEVQLTDHKRKSDEECVSPDRRRTRY 283 PHL++ ++ EE Q ++KRKS EE SPD+ RT++ Sbjct: 142 PHLLKSRVKEEEEQSINNKRKSMEENHSPDKSRTKF 177 >XP_016724385.1 PREDICTED: two-component response regulator ARR8-like [Gossypium hirsutum] Length = 189 Score = 142 bits (357), Expect = 3e-40 Identities = 72/102 (70%), Positives = 84/102 (82%), Gaps = 2/102 (1%) Frame = +2 Query: 2 PGMTGYDLLRKIKESTSLKDIPVVIMSSENEPARINRCLEEGAEEFFLKPVQLSDVNKLK 181 PGMTGYDLLRKIK+S+S KDIPVVIMSSEN P+RINRCLE+GAEEFFLKPV+LSDVNKL+ Sbjct: 88 PGMTGYDLLRKIKQSSSFKDIPVVIMSSENIPSRINRCLEDGAEEFFLKPVKLSDVNKLR 147 Query: 182 PHLMR--KKIEEVQLTDHKRKSDEECVSPDRRRTRYDEPELL 301 PHLM+ E+Q +KRK EE SPDR R RY+E E++ Sbjct: 148 PHLMKGITTKNEMQSNTNKRKGSEEIQSPDRTRPRYNELEVV 189 >XP_012460026.1 PREDICTED: two-component response regulator ARR8-like [Gossypium raimondii] KJB74992.1 hypothetical protein B456_012G017600 [Gossypium raimondii] Length = 189 Score = 142 bits (357), Expect = 3e-40 Identities = 72/102 (70%), Positives = 84/102 (82%), Gaps = 2/102 (1%) Frame = +2 Query: 2 PGMTGYDLLRKIKESTSLKDIPVVIMSSENEPARINRCLEEGAEEFFLKPVQLSDVNKLK 181 PGMTGYDLLRKIK+S+S KDIPVVIMSSEN P+RINRCLE+GAEEFFLKPV+LSDVNKL+ Sbjct: 88 PGMTGYDLLRKIKQSSSFKDIPVVIMSSENIPSRINRCLEDGAEEFFLKPVKLSDVNKLR 147 Query: 182 PHLMR--KKIEEVQLTDHKRKSDEECVSPDRRRTRYDEPELL 301 PHLM+ E+Q +KRK EE SPDR R RY+E E++ Sbjct: 148 PHLMKGITTKNEMQSNTNKRKGSEEIQSPDRTRPRYNELEVV 189 >XP_016728049.1 PREDICTED: two-component response regulator ARR8-like [Gossypium hirsutum] XP_017616051.1 PREDICTED: two-component response regulator ARR8-like [Gossypium arboreum] Length = 189 Score = 141 bits (356), Expect = 5e-40 Identities = 72/102 (70%), Positives = 84/102 (82%), Gaps = 2/102 (1%) Frame = +2 Query: 2 PGMTGYDLLRKIKESTSLKDIPVVIMSSENEPARINRCLEEGAEEFFLKPVQLSDVNKLK 181 PGMTGYDLLRKIK+S+S KDIPVVIMSSEN P+RINRCLE+GAEEFFLKPV+LSDVNKL+ Sbjct: 88 PGMTGYDLLRKIKQSSSFKDIPVVIMSSENIPSRINRCLEDGAEEFFLKPVKLSDVNKLR 147 Query: 182 PHLMR--KKIEEVQLTDHKRKSDEECVSPDRRRTRYDEPELL 301 PHLM+ E+Q +KRK EE SPDR R RY+E E++ Sbjct: 148 PHLMKGITTKTEMQSNTNKRKGSEEIQSPDRTRPRYNELEVV 189 >KDO49056.1 hypothetical protein CISIN_1g046192mg [Citrus sinensis] Length = 187 Score = 141 bits (355), Expect = 7e-40 Identities = 74/99 (74%), Positives = 83/99 (83%), Gaps = 3/99 (3%) Frame = +2 Query: 2 PGMTGYDLLRKIKESTSLKDIPVVIMSSENEPARINRCLEEGAEEFFLKPVQLSDVNKLK 181 PGMTGYDLLRKIKES SLKDIPVVIMSSEN P+RINRCLEEGAEEFFLKPVQL+DVNKLK Sbjct: 74 PGMTGYDLLRKIKESASLKDIPVVIMSSENIPSRINRCLEEGAEEFFLKPVQLADVNKLK 133 Query: 182 PHLMR---KKIEEVQLTDHKRKSDEECVSPDRRRTRYDE 289 PHLM+ K+I+E ++KRK EE S DR RTR ++ Sbjct: 134 PHLMKGISKEIKEPNNINNKRKGLEEIDSADRTRTRLND 172