BLASTX nr result
ID: Angelica27_contig00027370
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00027370 (253 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017220869.1 PREDICTED: AT-hook motif nuclear-localized protei... 67 2e-11 XP_017216623.1 PREDICTED: AT-hook motif nuclear-localized protei... 59 2e-08 >XP_017220869.1 PREDICTED: AT-hook motif nuclear-localized protein 20-like [Daucus carota subsp. sativus] KZM85288.1 hypothetical protein DCAR_027290 [Daucus carota subsp. sativus] Length = 281 Score = 67.4 bits (163), Expect = 2e-11 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -2 Query: 246 MANPWWTGQVGLLQGINPGGSPLMLNNKINPDLAI 142 MANPWWTGQVGLL G+NPGGSPLMLNNK D+AI Sbjct: 1 MANPWWTGQVGLLPGMNPGGSPLMLNNKTQQDVAI 35 >XP_017216623.1 PREDICTED: AT-hook motif nuclear-localized protein 19-like isoform X1 [Daucus carota subsp. sativus] XP_017216624.1 PREDICTED: AT-hook motif nuclear-localized protein 19-like isoform X1 [Daucus carota subsp. sativus] XP_017216625.1 PREDICTED: AT-hook motif nuclear-localized protein 19-like isoform X1 [Daucus carota subsp. sativus] XP_017216626.1 PREDICTED: AT-hook motif nuclear-localized protein 19-like isoform X1 [Daucus carota subsp. sativus] XP_017216628.1 PREDICTED: AT-hook motif nuclear-localized protein 19-like isoform X1 [Daucus carota subsp. sativus] XP_017216629.1 PREDICTED: AT-hook motif nuclear-localized protein 19-like isoform X1 [Daucus carota subsp. sativus] KZM87102.1 hypothetical protein DCAR_024236 [Daucus carota subsp. sativus] Length = 284 Score = 59.3 bits (142), Expect = 2e-08 Identities = 32/61 (52%), Positives = 34/61 (55%) Frame = -2 Query: 246 MANPWWTGQVGLLQGINPGGSPLMLNNKINPDLAIXXXXXXXXXXXXXXXXXXXXEGAVV 67 MANPWWTGQVGLL GI+P SPLMLNNK DL + EGAVV Sbjct: 1 MANPWWTGQVGLLPGIDPRASPLMLNNKTQHDLEMNNNNSGGDDEDERDNCDEPTEGAVV 60 Query: 66 V 64 V Sbjct: 61 V 61