BLASTX nr result
ID: Angelica27_contig00027076
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00027076 (315 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017225673.1 PREDICTED: pentatricopeptide repeat-containing pr... 86 1e-17 >XP_017225673.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22670, mitochondrial-like [Daucus carota subsp. sativus] XP_017225674.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22670, mitochondrial-like [Daucus carota subsp. sativus] KZM83107.1 hypothetical protein DCAR_030676 [Daucus carota subsp. sativus] Length = 562 Score = 86.3 bits (212), Expect = 1e-17 Identities = 42/59 (71%), Positives = 50/59 (84%) Frame = +3 Query: 138 MLFKLAKVRALSRFGSRVELKVCRGDVYPRNGVCGLLCSSFSSMTVSKEVDESSDVNES 314 MLFKLAK A RF +R ++KVCRGDVY RNGVC LLCSSFSSMT+SK+VDE+S++ ES Sbjct: 1 MLFKLAKFGAFWRFRTRFDVKVCRGDVYTRNGVCSLLCSSFSSMTMSKDVDEASNLVES 59